|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 9)| Asymmetric Unit (3, 9) Biological Unit 1 (2, 6) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3U5S) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3U5S) |
SAPs(SNPs)/Variants (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)| Asymmetric Unit (1, 1) Biological Unit 1 (1, 2) |
Exons (0, 0)| (no "Exon" information available for 3U5S) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:126 aligned with ALR_HUMAN | P55789 from UniProtKB/Swiss-Prot Length:205 Alignment length:126 89 99 109 119 129 139 149 159 169 179 189 199 ALR_HUMAN 80 WMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 205 SCOP domains d3u5sa_ A: Augmenter of liver regeneration SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------L---------------------------H----------- SAPs(SNPs) PROSITE ---------------ERV_ALR PDB: A:96-195 UniProt: 95-195 ---------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript 3u5s A 80 SmRTQQKRDTKFREDxPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDmAQFIHLFSKFYPxEExAEDLRKRLARNHPDTRTRAAFTQWLxHLHNEVNRKLGKPDFDxSKVDERWRDGWKDGSxD 205 | 89 | 99 109 119 129 139 | | 149 159 169 | 179 189 199 | | 95-SEC 129-MSE 142-SEC 171-SEC 188-SEC 204-SEC 81-MSE 145-SEC
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3U5S) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3U5S) |
Gene Ontology (11, 11)|
Asymmetric Unit(hide GO term definitions) Chain A (ALR_HUMAN | P55789)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|