|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3PYJ) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3PYJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3PYJ) |
Exons (0, 0)| (no "Exon" information available for 3PYJ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:96 aligned with MONA_DIOCU | P02881 from UniProtKB/Swiss-Prot Length:45 Alignment length:96 1 - - - - - | 9 19 29 39 MONA_DIOCU - ---------------------------------------------------FREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 45 SCOP domains d3pyja_ A: Monellin, B & A chains together SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains Monellin-3pyjA02 A:1-40 ------------Monellin-3pyjA01 A:53-95 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 3pyj A 1 GEWEIIDIGPFTQNLAKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 96 10 20 30 40 50 60 70 80 90 Chain A from PDB Type:PROTEIN Length:96 aligned with MONB_DIOCU | P02882 from UniProtKB/Swiss-Prot Length:50 Alignment length:96 50 10 20 30 40 50 - - - - MONB_DIOCU 1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEEN---------------------------------------------- - SCOP domains d3pyja_ A: Monellin, B & A chains together SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains Monellin-3pyjA02 A:1-40 ------------Monellin-3pyjA01 A:53-95 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 3pyj A 1 GEWEIIDIGPFTQNLAKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 96 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3PYJ) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3PYJ)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|