Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SINGLE CHAIN MONELLIN
 
Authors :  T. Tamada, Y. Kato, R. Kuroki
Date :  15 Mar 02  (Deposition) - 07 Oct 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Alpha+Beta, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Kato, T. Tamada, H. Sone, H. Iijima, R. Kuroki
The Effect Of Single Chain Derivatization On The Structure And Stability Of The Monellin
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MONELLIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI STR. K12 SUBSTR. W3110
    Expression System PlasmidPST6311
    Expression System StrainW3110
    Expression System Taxid316407
    Expression System Vector TypePLASMID
    Organism CommonSERENDIPITY BERRY
    Organism ScientificDIOSCOREOPHYLLUM CUMMINSII
    Organism Taxid3457
    Other DetailsFUSION PROTEIN CONCERNING CHAIN A COMPRISE RESIDUES 1-50 (MONELLIN, CHAIN B) AND 52-96 (MONELLIN, CHAIN A), INCLUDING GLYSINE LINKER. FUSION PROTEIN CONCERNING CHAIN B COMPRISE RESIDUES 101-150 (MONELLIN, CHAIN B) AND 152-196 (MONELLIN, CHAIN A), INCLUDING GLYSINE LINKER.

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1IV9)

(-) Sites  (0, 0)

(no "Site" information available for 1IV9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1IV9)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Arg A:39 -Pro A:40
2Gly A:91 -Pro A:92
3Arg B:139 -Pro B:140
4Gly B:191 -Pro B:192

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1IV9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1IV9)

(-) Exons   (0, 0)

(no "Exon" information available for 1IV9)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:96
 aligned with MONA_DIOCU | P02881 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:96
                                                                               1                                            
                                     -         -         -         -         - |       9        19        29        39      
           MONA_DIOCU     - ---------------------------------------------------FREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP  45
               SCOP domains d1iv9a_ A: Monellin, B & A chains together                                                       SCOP domains
               CATH domains 1iv9A00 A:1-96  [code=3.10.450.10, no name defined]                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeee.......eeeeeeeeeeee..eeeeeeeeee.....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                 1iv9 A   1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEENGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP  96
                                    10        20        30        40        50        60        70        80        90      

Chain A from PDB  Type:PROTEIN  Length:96
 aligned with MONB_DIOCU | P02882 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:96
                                                                            50                                              
                                    10        20        30        40        50         -         -         -         -      
           MONB_DIOCU     1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEEN----------------------------------------------   -
               SCOP domains d1iv9a_ A: Monellin, B & A chains together                                                       SCOP domains
               CATH domains 1iv9A00 A:1-96  [code=3.10.450.10, no name defined]                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeee.......eeeeeeeeeeee..eeeeeeeeee.....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                 1iv9 A   1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEENGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP  96
                                    10        20        30        40        50        60        70        80        90      

Chain B from PDB  Type:PROTEIN  Length:92
 aligned with MONA_DIOCU | P02881 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:92
                                                             1              2                                           
                                     -         -         -   |     -        |3        13        23        33        43  
           MONA_DIOCU     - ---------------------------------F--------------REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP  45
               SCOP domains d1iv9b_ B: Monellin, B & A chains together                                                   SCOP domains
               CATH domains 1iv9B00 B:101-196  [code=3.10.450.10, no name defined]                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeee...eeeeeeeeeeee..eeeeeeeeee.....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                 1iv9 B 101 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 196
                                   110       120       130       140       154       164       174       184       194  
                                                                         148|                                           
                                                                          153                                           

Chain B from PDB  Type:PROTEIN  Length:92
 aligned with MONB_DIOCU | P02882 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:92
                                                                                                    50                  
                                                                          48                       49|                  
                                    10        20        30        40       | -         -         -  ||     -         -  
           MONB_DIOCU     1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYE------------------------EN------------------   -
               SCOP domains d1iv9b_ B: Monellin, B & A chains together                                                   SCOP domains
               CATH domains 1iv9B00 B:101-196  [code=3.10.450.10, no name defined]                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeee...eeeeeeeeeeee..eeeeeeeeee.....eeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                 1iv9 B 101 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 196
                                   110       120       130       140       154       164       174       184       194  
                                                                         148|                                           
                                                                          153                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IV9)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1IV9)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1iv9)
 
  Sites
(no "Sites" information available for 1iv9)
 
  Cis Peptide Bonds
    Arg A:39 - Pro A:40   [ RasMol ]  
    Arg B:139 - Pro B:140   [ RasMol ]  
    Gly A:91 - Pro A:92   [ RasMol ]  
    Gly B:191 - Pro B:192   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1iv9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MONA_DIOCU | P02881
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  MONB_DIOCU | P02882
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MONA_DIOCU | P02881
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MONB_DIOCU | P02882
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MONA_DIOCU | P028811fa3 1fuw 1iv7 1krl 1m9g 1mnl 2gpk 2o9u 3mon 3pxm 3pyj 3q2p 4mon 5lc6 5lc7
        MONB_DIOCU | P028821fa3 1fuw 1iv7 1krl 1m9g 1mnl 1mol 2o9u 3mon 3pxm 3pyj 3q2p 4mon 5lc6 5lc7

(-) Related Entries Specified in the PDB File

1iv7 1IV7 CONTAINS CRYSTAL STRUCTURE OF THE SAME PROTEIN (MUTANT, E49N, N50E)