Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF A NANOBODY-STABILIZED ACTIVE STATE OF THE BETA2 ADRENOCEPTOR
 
Authors :  S. G. F. Rasmussen, H. -J. Choi, J. J. Fung, E. Pardon, P. Casarosa, P. S. C B. T. Devree, D. M. Rosenbaum, F. S. Thian, T. S. Kobilka, A. Schnapp, I. R. K. Sunahara, S. H. Gellman, A. Pautsch, J. Steyaert, W. I. Weis, B. K.
Date :  28 Sep 10  (Deposition) - 19 Jan 11  (Release) - 04 May 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Beta-2 Adrenoceptor, Agonist, Nanobody, 7Tm, Gpcr, Membrane, Signaling Protein, Hydrolase, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. G. Rasmussen, H. J. Choi, J. J. Fung, E. Pardon, P. Casarosa, P. S. Chae, B. T. Devree, D. M. Rosenbaum, F. S. Thian, T. S. Kobilka, A. Schnapp, I. Konetzki, R. K. Sunahara, S. H. Gellman, A. Pautsch, J. Steyaert, W. I. Weis, B. K. Kobilka
Structure Of A Nanobody-Stabilized Active State Of The B2 Adrenoceptor
Nature V. 469 175 2011
PubMed-ID: 21228869  |  Reference-DOI: 10.1038/NATURE09648

(-) Compounds

Molecule 1 - BETA-2 ADRENERGIC RECEPTOR, LYSOZYME
    ChainsA
    EC Number3.2.1.17
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    FragmentUNP P07550 RESIDUES 1-230, 263-365, UNP P00720 RESIDUES 2- 161
    GeneADRB2, ADRB2R, B2AR, E
    MutationYES
    Organism CommonHUMAN, BACTERIOPHAGE T4
    Organism ScientificHOMO SAPIENS, ENTEROBACTERIA PHAGE T4
    Organism Taxid9606, 10665
    Other DetailsBETA-2-ADRENERGIC RECEPTOR/T4-LYSOZYME CHIMERA
    SynonymENDOLYSIN, LYSIS PROTEIN, MURAMIDASE
 
Molecule 2 - CAMELID ANTIBODY FRAGMENT
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificLAMA GLAMA
    Organism Taxid9844
    Other DetailsNANOBODY

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1P0G1Ligand/Ion8-[(1R)-2-{[1,1-DIMETHYL-2-(2-METHYLPHENYL)ETHYL]AMINO}-1-HYDROXYETHYL]-5-HYDROXY-2H-1,4-BENZOXAZIN-3(4H)-ONE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:109 , ASP A:113 , VAL A:117 , CYS A:191 , PHE A:193 , ALA A:200 , SER A:203 , SER A:207 , PHE A:289 , PHE A:290 , ASN A:293 , TYR A:308 , ILE A:309 , ASN A:312BINDING SITE FOR RESIDUE P0G A 366

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:106 -A:191
2A:184 -A:190
3B:22 -B:95

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly B:101 -Ala B:102

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (6, 6)

Asymmetric/Biological Unit (6, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_003453E27QADRB2_HUMANPolymorphism1042714AQ27Q
2UniProtVAR_003454V34MADRB2_HUMANPolymorphism  ---AV34M
3UniProtVAR_009125I159FADRB2_HUMANPolymorphism  ---AI159F
4UniProtVAR_009124I159LADRB2_HUMANPolymorphism  ---AI159L
5UniProtVAR_003455T164IADRB2_HUMANPolymorphism1800888AT164I
6UniProtVAR_025101S220CADRB2_HUMANPolymorphism3729943AS220C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F1_1PS00237 G-protein coupled receptors family 1 signature.ADRB2_HUMAN119-135  1A:119-135

(-) Exons   (1, 1)

Asymmetric/Biological Unit (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003059881ENSE00001154479chr5:148206156-1482081882033ADRB2_HUMAN1-4934931A:23-344 (gaps)322

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:284
 aligned with ADRB2_HUMAN | P07550 from UniProtKB/Swiss-Prot  Length:413

    Alignment length:322
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342  
          ADRB2_HUMAN    23 DVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRR 344
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------7tm_1-3p0gA01 A:50-326                                                                                                                                                                                                                                                               ------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh--------------------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.... Sec.struct. author
             SAPs(SNPs) (1) ----Q------M----------------------------------------------------------------------------------------------------------------------------F----I-------------------------------------------------------C---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------------------------L----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------G_PROTEIN_RECEP_F----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: A:23-344 (gaps) UniProt: 1-493 [INCOMPLETE]                                                                                                                                                                                                                                                                         Transcript 1
                 3p0g A  23 DVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAK--------------------------------------LKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRR 344
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222    |    -         -         -         -   |   272       282       292       302       312       322       332       342  
                                                                                                                                                                                                                                      227                                    266                                                                              

Chain B from PDB  Type:PROTEIN  Length:121
                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee....ee..eeeeeeeeee......eeeeeeee.....eeeeeeee....eee........eeeee....eeeeeeeee.....eeeeeeeee.......eeee...eee.ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p0g B   2 VQLQESGGGLVQAGGSLRLSCAASGSIFSINTMGWYRQAPGKQRELVAAIHSGGSTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDYGAVLYEYDYWGQGTQVTVSSHH 122
                                    11        21        31        41        51        61        71        81        91       101       111       121 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3P0G)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3P0G)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: GPCR_A (90)

(-) Gene Ontology  (108, 108)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ADRB2_HUMAN | P07550)
molecular function
    GO:0031713    B2 bradykinin receptor binding    Interacting selectively and non-covalently with a B2 bradykinin receptor.
    GO:0001965    G-protein alpha-subunit binding    Interacting selectively and non-covalently with a G-protein alpha subunit. The alpha subunit binds a guanine nucleotide.
    GO:0004930    G-protein coupled receptor activity    Combining with an extracellular signal and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
    GO:0008179    adenylate cyclase binding    Interacting selectively and non-covalently with the enzyme adenylate cyclase.
    GO:0004935    adrenergic receptor activity    Combining with epinephrine or norepinephrine and transmitting the signal across the membrane by activating the alpha-subunit of an associated heterotrimeric G-protein complex.
    GO:0004941    beta2-adrenergic receptor activity    Combining with epinephrine or norepinephrine to initiate a change in cell activity via activation of a G protein, with pharmacological characteristics of beta2-adrenergic receptors.
    GO:0035240    dopamine binding    Interacting selectively and non-covalently with dopamine, a catecholamine neurotransmitter formed by aromatic-L-amino-acid decarboxylase from 3,4-dihydroxy-L-phenylalanine.
    GO:0008144    drug binding    Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0051379    epinephrine binding    Interacting selectively and non-covalently with epinephrine, a hormone produced by the medulla of the adrenal glands that increases heart activity, improves the power and prolongs the action of muscles, and increases the rate and depth of breathing. It is synthesized by the methylation of norepinephrine.
    GO:0035255    ionotropic glutamate receptor binding    Interacting selectively and non-covalently with an ionotropic glutamate receptor. Ionotropic glutamate receptors bind glutamate and exert an effect through the regulation of ion channels.
    GO:0051380    norepinephrine binding    Interacting selectively and non-covalently with norepinephrine, (3,4-dihydroxyphenyl-2-aminoethanol), a hormone secreted by the adrenal medulla and a neurotransmitter in the sympathetic peripheral nervous system and in some tracts of the CNS. It is also the biosynthetic precursor of epinephrine.
    GO:0015459    potassium channel regulator activity    Modulates potassium channel activity via direct interaction interaction with a potassium channel (binding or modification).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0032403    protein complex binding    Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0007190    activation of adenylate cyclase activity    Any process that initiates the activity of the inactive enzyme adenylate cyclase.
    GO:0007171    activation of transmembrane receptor protein tyrosine kinase activity    Any process that initiates the activity of the inactive transmembrane receptor protein tyrosine kinase activity.
    GO:0007189    adenylate cyclase-activating G-protein coupled receptor signaling pathway    The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through activation of adenylyl cyclase activity and a subsequent increase in the concentration of cyclic AMP (cAMP).
    GO:0071880    adenylate cyclase-activating adrenergic receptor signaling pathway    The series of molecular signals generated as a consequence of an adrenergic receptor binding to its physiological ligand, where the pathway proceeds with activation of adenylyl cyclase and a subsequent increase in the concentration of cyclic AMP (cAMP).
    GO:0007188    adenylate cyclase-modulating G-protein coupled receptor signaling pathway    The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through activation or inhibition of adenylyl cyclase activity and a subsequent change in the concentration of cyclic AMP (cAMP).
    GO:0007568    aging    A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
    GO:0008306    associative learning    Learning by associating a stimulus (the cause) with a particular outcome (the effect).
    GO:0045453    bone resorption    The process in which specialized cells known as osteoclasts degrade the organic and inorganic portions of bone, and endocytose and transport the degradation products.
    GO:0050873    brown fat cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a brown adipocyte, an animal connective tissue cell involved in adaptive thermogenesis. Brown adipocytes contain multiple small droplets of triglycerides and a high number of mitochondria.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0071456    cellular response to hypoxia    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0002032    desensitization of G-protein coupled receptor protein signaling pathway by arrestin    The process that inhibits the signaling function of a G-protein coupled receptor by uncoupling the receptor from its downstream G proteins.
    GO:0002086    diaphragm contraction    A process in which force is generated within involuntary skeletal muscle tissue, resulting in a change in muscle geometry. This process occurs in the diaphragm. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. The diaphragm is a striated muscle that is necessary for the process of respiratory gaseous exchange.
    GO:0002024    diet induced thermogenesis    The process that results in increased metabolic rate in tissues of an organism. It is triggered by the detection of dietary excess. This process is achieved via signalling in the sympathetic nervous system.
    GO:0008333    endosome to lysosome transport    The directed movement of substances from endosomes to lysosomes.
    GO:0044849    estrous cycle    A type of ovulation cycle, which occurs in most mammalian therian females, where the endometrium is resorbed if pregnancy does not occur.
    GO:0060079    excitatory postsynaptic potential    A process that leads to a temporary increase in postsynaptic potential due to the flow of positively charged ions into the postsynaptic cell. The flow of ions that causes an EPSP is an excitatory postsynaptic current (EPSC) and makes it easier for the neuron to fire an action potential.
    GO:0007565    female pregnancy    The set of physiological processes that allow an embryo or foetus to develop within the body of a female animal. It covers the time from fertilization of a female ovum by a male spermatozoon until birth.
    GO:0031649    heat generation    Any homeostatic process in which an organism produces heat, thereby raising its internal temperature.
    GO:0001889    liver development    The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
    GO:0097421    liver regeneration    The regrowth of lost or destroyed liver.
    GO:0016525    negative regulation of angiogenesis    Any process that stops, prevents, or reduces the frequency, rate or extent of angiogenesis.
    GO:0050728    negative regulation of inflammatory response    Any process that stops, prevents, or reduces the frequency, rate or extent of the inflammatory response.
    GO:0040015    negative regulation of multicellular organism growth    Any process that stops, prevents, or reduces the frequency, rate or extent of growth of an organism to reach its usual body size.
    GO:0030279    negative regulation of ossification    Any process that stops, prevents, or reduces the frequency, rate or extent of bone formation.
    GO:0090331    negative regulation of platelet aggregation    Any process that decreases the rate, frequency or extent of platelet aggregation. Platelet aggregation is the adhesion of one platelet to one or more other platelets via adhesion molecules.
    GO:0045986    negative regulation of smooth muscle contraction    Any process that stops, prevents, or reduces the frequency, rate or extent of smooth muscle contraction.
    GO:0035811    negative regulation of urine volume    Any process that decreases the amount of urine excreted from the body over a unit of time.
    GO:0002025    norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure    A process that results in an increase in the diameter of an artery during the norepinephrine-epinephrine response to blood pressure change.
    GO:0032781    positive regulation of ATPase activity    Any process that activates or increases the rate of ATP hydrolysis by an ATPase.
    GO:0043410    positive regulation of MAPK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:1901098    positive regulation of autophagosome maturation    Any process that activates or increases the frequency, rate or extent of autophagosome maturation.
    GO:0030501    positive regulation of bone mineralization    Any process that activates or increases the frequency, rate or extent of bone mineralization.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0045823    positive regulation of heart contraction    Any process that activates or increases the frequency, rate or extent of heart contraction.
    GO:1904504    positive regulation of lipophagy    Any process that activates or increases the frequency, rate or extent of lipophagy.
    GO:1904925    positive regulation of mitophagy in response to mitochondrial depolarization    Any process that activates or increases the frequency, rate or extent of mitophagy in response to mitochondrial depolarization.
    GO:0043268    positive regulation of potassium ion transport    Any process that activates or increases the frequency, rate or extent of the directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0031398    positive regulation of protein ubiquitination    Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0048633    positive regulation of skeletal muscle tissue growth    Any process that activates, maintains or increases the rate of skeletal muscle growth.
    GO:0010765    positive regulation of sodium ion transport    Any process that increases the frequency, rate or extent of the directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0003059    positive regulation of the force of heart contraction by epinephrine    The process in which the secretion of epinephrine into the bloodstream or released from nerve endings modulates the force of heart muscle contraction.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
    GO:0051924    regulation of calcium ion transport    Any process that modulates the frequency, rate or extent of the directed movement of calcium ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0051930    regulation of sensory perception of pain    Any process that modulates the frequency, rate or extent of the sensory perception of pain, the series of events required for an organism to receive a painful stimulus, convert it to a molecular signal, and recognize and characterize the signal.
    GO:0006940    regulation of smooth muscle contraction    Any process that modulates the frequency, rate or extent of smooth muscle contraction.
    GO:0002028    regulation of sodium ion transport    Any process that modulates the frequency, rate or extent of the directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0001993    regulation of systemic arterial blood pressure by norepinephrine-epinephrine    The process in which the secretion of norepinephrine or epinephrine into the bloodstream modulates the force with which blood passes through the circulatory system.
    GO:0009409    response to cold    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cold stimulus, a temperature stimulus below the optimal temperature for that organism.
    GO:0071548    response to dexamethasone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a dexamethasone stimulus.
    GO:0043627    response to estrogen    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by an estrogen, C18 steroid hormones that can stimulate the development of female sexual characteristics.
    GO:0001666    response to hypoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0071867    response to monoamine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a monoamine stimulus. A monoamine is any of a group of molecular messengers that contain one amino group that is connected to an aromatic ring by ethylene group (-CH2-CH2-). Monoamines are derived from the aromatic amino acids phenylalanine, tyrosine, histidine and tryptophan.
    GO:0032570    response to progesterone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a progesterone stimulus.
    GO:0033574    response to testosterone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a testosterone stimulus.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0035249    synaptic transmission, glutamatergic    The vesicular release of glutamate from a presynapse, across a chemical synapse, the subsequent activation of glutamate receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0016324    apical plasma membrane    The region of the plasma membrane located at the apical end of the cell.
    GO:0030424    axon    The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
    GO:0005901    caveola    A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0043197    dendritic spine    A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0032809    neuronal cell body membrane    The plasma membrane of a neuron cell body - excludes the plasma membrane of cell projections such as axons and dendrites.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0042383    sarcolemma    The outer membrane of a muscle cell, consisting of the plasma membrane, a covering basement membrane (about 100 nm thick and sometimes common to more than one fiber), and the associated loose network of collagen fibers.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    P0G  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly B:101 - Ala B:102   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3p0g
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ADRB2_HUMAN | P07550
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ENLYS_BPT4 | P00720
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.17
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ADRB2_HUMAN | P07550
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ENLYS_BPT4 | P00720
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ADRB2_HUMAN | P075501gq4 2r4r 2r4s 2rh1 3d4s 3kj6 3ny8 3ny9 3nya 3pds 3sn6 4gbr 4lde 4ldl 4ldo 4qkx 5d5a 5d5b 5d6l 5jqh
        ENLYS_BPT4 | P00720102l 103l 104l 107l 108l 109l 110l 111l 112l 113l 114l 115l 118l 119l 120l 122l 123l 125l 126l 127l 128l 129l 130l 131l 137l 138l 139l 140l 141l 142l 143l 144l 145l 146l 147l 148l 149l 150l 151l 152l 155l 156l 157l 158l 159l 160l 161l 162l 163l 164l 165l 166l 167l 168l 169l 170l 171l 172l 173l 174l 175l 176l 177l 178l 180l 181l 182l 183l 184l 185l 186l 187l 188l 189l 190l 191l 192l 195l 196l 197l 198l 199l 1b6i 1c60 1c61 1c62 1c63 1c64 1c65 1c66 1c67 1c68 1c69 1c6a 1c6b 1c6c 1c6d 1c6e 1c6f 1c6g 1c6h 1c6i 1c6j 1c6k 1c6l 1c6m 1c6n 1c6p 1c6q 1c6t 1ctw 1cu0 1cu2 1cu3 1cu5 1cu6 1cup 1cuq 1cv0 1cv1 1cv3 1cv4 1cv5 1cv6 1cvk 1cx6 1cx7 1d2w 1d2y 1d3f 1d3j 1d3m 1d3n 1d9w 1dya 1dyb 1dyc 1dyd 1dye 1dyf 1dyg 1epy 1g06 1g07 1g0g 1g0j 1g0k 1g0l 1g0m 1g0p 1g0q 1g1v 1g1w 1i6s 1jqu 1jtm 1jtn 1kni 1ks3 1kw5 1kw7 1ky0 1ky1 1l00 1l01 1l02 1l03 1l04 1l05 1l06 1l07 1l08 1l09 1l0j 1l0k 1l10 1l11 1l12 1l13 1l14 1l15 1l16 1l17 1l18 1l19 1l20 1l21 1l22 1l23 1l24 1l25 1l26 1l27 1l28 1l29 1l30 1l31 1l32 1l33 1l34 1l35 1l36 1l37 1l38 1l39 1l40 1l41 1l42 1l43 1l44 1l45 1l46 1l47 1l48 1l49 1l50 1l51 1l52 1l53 1l54 1l55 1l56 1l57 1l58 1l59 1l60 1l61 1l62 1l63 1l64 1l65 1l66 1l67 1l68 1l69 1l70 1l71 1l72 1l73 1l74 1l75 1l76 1l77 1l79 1l80 1l81 1l82 1l83 1l84 1l85 1l86 1l87 1l88 1l89 1l90 1l91 1l92 1l93 1l94 1l95 1l96 1l97 1l98 1l99 1lgu 1lgw 1lgx 1li2 1li3 1li6 1llh 1lpy 1lw9 1lwg 1lwk 1lyd 1lye 1lyf 1lyg 1lyh 1lyi 1lyj 1nhb 1ov5 1ov7 1ovh 1ovj 1ovk 1owy 1owz 1oyu 1p2l 1p2r 1p36 1p37 1p3n 1p46 1p56 1p5c 1p64 1p6y 1p7s 1pqd 1pqi 1pqj 1pqk 1pqm 1pqo 1qs5 1qs9 1qsb 1qsq 1qt3 1qt4 1qt5 1qt6 1qt7 1qt8 1qtb 1qtc 1qtd 1qth 1qtv 1qtz 1qud 1qug 1quh 1quo 1ssw 1ssy 1swy 1swz 1sx2 1sx7 1t6h 1t8a 1t8f 1t8g 1t97 1tla 1xep 1zur 1zwn 1zyt 200l 201l 205l 206l 209l 210l 211l 212l 213l 214l 215l 216l 217l 218l 219l 220l 221l 222l 223l 224l 225l 226l 227l 228l 229l 230l 231l 232l 233l 234l 235l 236l 237l 238l 239l 240l 241l 242l 243l 244l 245l 246l 247l 248l 249l 250l 251l 252l 253l 254l 255l 256l 257l 258l 259l 260l 261l 262l 2a4t 2b6t 2b6w 2b6x 2b6y 2b6z 2b70 2b72 2b73 2b74 2b75 2b7x 2cuu 2f2q 2f32 2f47 2huk 2hul 2hum 2igc 2l78 2lc9 2lcb 2lzm 2ntg 2nth 2o4w 2o79 2o7a 2oe4 2oe7 2oe9 2oea 2oty 2otz 2ou0 2ou8 2ou9 2q9d 2q9e 2qar 2qb0 2ray 2raz 2rb0 2rb1 2rb2 2rbn 2rbo 2rbp 2rbq 2rbr 2rbs 2rh1 3c7w 3c7y 3c7z 3c80 3c81 3c82 3c83 3c8q 3c8r 3c8s 3cdo 3cdq 3cdr 3cdt 3cdv 3d4s 3dke 3dmv 3dmx 3dmz 3dn0 3dn1 3dn2 3dn3 3dn4 3dn6 3dn8 3dna 3eml 3f8v 3f9l 3fa0 3fad 3fi5 3g3v 3g3w 3g3x 3gui 3guj 3guk 3gul 3gum 3gun 3guo 3gup 3hh3 3hh4 3hh5 3hh6 3ht6 3ht7 3ht8 3ht9 3htb 3htd 3htf 3htg 3hu8 3hu9 3hua 3huk 3huq 3hwl 3jr6 3k2r 3l2x 3l64 3lzm 3ny8 3ny9 3nya 3odu 3oe0 3oe6 3oe8 3oe9 3pbl 3pds 3qak 3run 3rze 3sb5 3sb6 3sb7 3sb8 3sb9 3sba 3sbb 3sn6 3uon 3v2w 3v2y 3vw7 4arj 4daj 4djh 4dkl 4e97 4ej4 4ekp 4ekq 4ekr 4eks 4epi 4exm 4gbr 4grv 4htt 4i7j 4i7k 4i7l 4i7m 4i7n 4i7o 4i7p 4i7q 4i7r 4i7s 4i7t 4iap 4k5y 4lde 4ldl 4ldo 4lzm 4n9n 4oo9 4phu 4rws 4s0w 4tn3 4u14 4w51 4w52 4w53 4w54 4w55 4w56 4w57 4w58 4w59 4w8f 4wtv 4xee 4xes 4yx7 4yxa 4yxc 4zwj 5b2g 5cgc 5cgd 5cxv 5d5a 5d5b 5d6l 5dgy 5dsg 5ee7 5eut 5ewx 5g27 5glh 5gli 5i14 5jdt 5jea 5jgn 5jgr 5jgu 5jgv 5jgx 5jgz 5jqh 5jws 5jwt 5jwu 5jwv 5jww 5kgr 5khz 5ki1 5ki2 5ki3 5ki8 5kig 5kii 5kim 5kio 5lwo 5lzm 5t04 5t1a 5tzr 5tzy 5vew 5vex 6lzm 7lzm

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3P0G)