3L5J - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF FNIII DOMAINS OF HUMAN GP130 (DOMAINS 4-6)

Authors :   N. J. Kershaw, J. -G. Zhang, T. P. J. Garrett, P. E. Czabotar

Date :   22 Dec 09 (Deposition) - 12 May 10 (Release) - 05 Apr 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.04

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Cytokine Receptor, Fibronectin Type Iii Domain, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Xu, N. J. Kershaw, C. S. Luo, P. Soo, M. J. Pocock, P. E. Czabotar, D. J. Hilton, N. A. Nicola, T. P. Garrett, J. G. Zhang
Crystal Structure Of The Entire Ectodomain Of Gp130: Insights Into The Molecular Assembly Of The Tall Cytokine Receptor Complexes.
J. Biol. Chem. V. 285 21214 2010
PubMed-ID: 20489211 | Reference-DOI: 10.1074/JBC.C110.129502

Molecule 1 - INTERLEUKIN-6 RECEPTOR SUBUNIT BETA
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-DUET
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 323-610
	Gene	:	GP130
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IL-6R-BETA, INTERLEUKIN-6 SIGNAL TRANSDUCER, MEMBRANE GLYCOPROTEIN 130, GP130, CDW130, ONCOSTATIN-M RECEPTOR SUBUNIT ALPHA

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 5)

No.	Name	Count	Type	Full Name
1	CL	4	Ligand/Ion	CHLORIDE ION
2	EDO	1	Ligand/Ion	1,2-ETHANEDIOL

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	EDO	1	Ligand/Ion	1,2-ETHANEDIOL

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION
2	EDO	-1	Ligand/Ion	1,2-ETHANEDIOL

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:401 , THR A:402 , TYR A:478 , ASP A:480 , GLY A:481 , PRO A:482 , GLY A:483	BINDING SITE FOR RESIDUE EDO A 1
2	AC2	SOFTWARE	SER A:309 , GLN A:450 , ARG A:461	BINDING SITE FOR RESIDUE CL A 589
3	AC3	SOFTWARE	SER B:309 , LYS B:330 , GLN B:449 , GLN B:450 , ARG B:461	BINDING SITE FOR RESIDUE CL B 1
4	AC4	SOFTWARE	LYS B:352 , TYR B:491 , GLN B:494	BINDING SITE FOR RESIDUE CL B 589
5	AC5	SOFTWARE	ARG B:537 , ARG B:569	BINDING SITE FOR RESIDUE CL B 590

Asymmetric Unit

No.	Residues
1	A:397	-	B:397
2	A:436	-	A:444
3	B:436	-	B:444

(no "Cis Peptide Bond" information available for 3L5J)

Asymmetric Unit (5, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_047784	L	397	V	IL6RB_HUMAN	Polymorphism	2228043	A/B	L	375	V
2	UniProt	VAR_036165	T	415	I	IL6RB_HUMAN	Unclassified	---	A/B	T	393	I
3	CancerSNP	VAR_IL6RB_HUMAN_CCDS3971_1_01 *	T	415	I	IL6RB_HUMAN	Disease (Colorectal cancer)	---	A/B	T	393	I
4	UniProt	VAR_047785	I	454	T	IL6RB_HUMAN	Polymorphism	2228046	A/B	I	432	T
5	UniProt	VAR_047786	V	499	I	IL6RB_HUMAN	Polymorphism	34417936	A/B	V	477	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_047784	L	397	V	IL6RB_HUMAN	Polymorphism	2228043	A	L	375	V
2	UniProt	VAR_036165	T	415	I	IL6RB_HUMAN	Unclassified	---	A	T	393	I
3	CancerSNP	VAR_IL6RB_HUMAN_CCDS3971_1_01 *	T	415	I	IL6RB_HUMAN	Disease (Colorectal cancer)	---	A	T	393	I
4	UniProt	VAR_047785	I	454	T	IL6RB_HUMAN	Polymorphism	2228046	A	I	432	T
5	UniProt	VAR_047786	V	499	I	IL6RB_HUMAN	Polymorphism	34417936	A	V	477	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_047784	L	397	V	IL6RB_HUMAN	Polymorphism	2228043	B	L	375	V
2	UniProt	VAR_036165	T	415	I	IL6RB_HUMAN	Unclassified	---	B	T	393	I
3	CancerSNP	VAR_IL6RB_HUMAN_CCDS3971_1_01 *	T	415	I	IL6RB_HUMAN	Disease (Colorectal cancer)	---	B	T	393	I
4	UniProt	VAR_047785	I	454	T	IL6RB_HUMAN	Polymorphism	2228046	B	I	432	T
5	UniProt	VAR_047786	V	499	I	IL6RB_HUMAN	Polymorphism	34417936	B	V	477	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	IL6RB_HUMAN	224-324 518-613 426-517 329-424	6	- A:496-588 B:496-588 A:404-495 B:404-495 A:307-402 B:307-402
2	HEMATOPO_REC_L_F2	PS01353	Long hematopoietin receptor, gp130 family signature.	IL6RB_HUMAN	404-457	2	A:382-435 B:382-435

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	IL6RB_HUMAN	224-324 518-613 426-517 329-424	3	- A:496-588 - A:404-495 - A:307-402 -
2	HEMATOPO_REC_L_F2	PS01353	Long hematopoietin receptor, gp130 family signature.	IL6RB_HUMAN	404-457	1	A:382-435 -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	IL6RB_HUMAN	224-324 518-613 426-517 329-424	3	- - B:496-588 - B:404-495 - B:307-402
2	HEMATOPO_REC_L_F2	PS01353	Long hematopoietin receptor, gp130 family signature.	IL6RB_HUMAN	404-457	1	- B:382-435

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000381298	1a	ENSE00001488125	chr5:55290772-55290612	161	IL6RB_HUMAN	-	0	0	-	-
1.2a	ENST00000381298	2a	ENSE00001488122	chr5:55278639-55278552	88	IL6RB_HUMAN	-	0	0	-	-
1.3c	ENST00000381298	3c	ENSE00002172585	chr5:55272121-55272043	79	IL6RB_HUMAN	1-22	22	0	-	-
1.4b	ENST00000381298	4b	ENSE00000914155	chr5:55265683-55265378	306	IL6RB_HUMAN	22-124	103	0	-	-
1.5	ENST00000381298	5	ENSE00000914153	chr5:55264224-55264104	121	IL6RB_HUMAN	124-164	41	0	-	-
1.6b	ENST00000381298	6b	ENSE00000914150	chr5:55260140-55259974	167	IL6RB_HUMAN	164-220	57	0	-	-
1.7	ENST00000381298	7	ENSE00000914147	chr5:55259334-55259180	155	IL6RB_HUMAN	220-271	52	0	-	-
1.8a	ENST00000381298	8a	ENSE00001006585	chr5:55256389-55256230	160	IL6RB_HUMAN	272-325	54	2	A:301-303 B:301-303	3 3
1.10	ENST00000381298	10	ENSE00000914138	chr5:55253119-55253037	83	IL6RB_HUMAN	325-352	28	2	A:303-330 (gaps) B:303-330 (gaps)	28 28
1.11a	ENST00000381298	11a	ENSE00001745568	chr5:55252063-55251853	211	IL6RB_HUMAN	353-423	71	2	A:331-401 B:331-401	71 71
1.12	ENST00000381298	12	ENSE00001685217	chr5:55250820-55250638	183	IL6RB_HUMAN	423-484	62	2	A:401-462 B:401-462	62 62
1.13	ENST00000381298	13	ENSE00001781723	chr5:55248179-55248078	102	IL6RB_HUMAN	484-518	35	2	A:462-496 B:462-496	35 35
1.14	ENST00000381298	14	ENSE00001750732	chr5:55247903-55247757	147	IL6RB_HUMAN	518-567	50	2	A:496-545 B:496-545	50 50
1.15a	ENST00000381298	15a	ENSE00001667221	chr5:55247432-55247292	141	IL6RB_HUMAN	567-614	48	2	A:545-588 B:545-588	44 44
1.17d	ENST00000381298	17d	ENSE00001743622	chr5:55243417-55243321	97	IL6RB_HUMAN	614-646	33	0	-	-
1.18	ENST00000381298	18	ENSE00001611906	chr5:55238579-55238498	82	IL6RB_HUMAN	646-673	28	0	-	-
1.19e	ENST00000381298	19e	ENSE00001488109	chr5:55237647-55230923	6725	IL6RB_HUMAN	674-918	245	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:283
 aligned with IL6RB_HUMAN | P40189 from UniProtKB/Swiss-Prot  Length:918

    Alignment length:288
                                   332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602        
          IL6RB_HUMAN   323 EDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT 610
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eeeeee.-----.eeeeeee...hhhhhh....eeeeeeee....eeeeee...eeeeee....eeeeeeee........eeeee...........eeeeeeee..eeeeeee.......eeeeeeee.........eeeeee....eee.........eeeeeeeeee..ee...eeeeee............eeee.....eeee....hhhhhh....eeeeeeee.....eeeeee....eeee.......eeeeeeeeee..eeee...eeee. Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------V-----------------I--------------------------------------T--------------------------------------------I--------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------I--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) FN----FN3  PDB: A:307-402 UniProt: 329-424                                                            -FN3  PDB: A:404-495 UniProt: 426-517                                                        FN3  PDB: A:496-588 UniProt: 518-613                                                          PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------HEMATOPO_REC_L_F2  PDB: A:382-435 UniProt: 404-457    --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) --Exon 1.10 UniProt: 325-352  Exon 1.11a  PDB: A:331-401 UniProt: 353-423                            ------------------------------------------------------------Exon 1.13  PDB: A:462-496          ------------------------------------------------Exon 1.15a  PDB: A:545-588 UniProt: 567-614  Transcript 1 (1)
           Transcript 1 (2) 1.8-------------------------------------------------------------------------------------------------Exon 1.12  PDB: A:401-462 UniProt: 423-484                    ---------------------------------Exon 1.14  PDB: A:496-545 UniProt: 518-567        ------------------------------------------- Transcript 1 (2)
                 3l5j A 301 EDRPSKAPSFWYKIDP-----YRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT 588
                                   310     |   - |     330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580        
                                         316   322

Chain B from PDB  Type:PROTEIN  Length:286
 aligned with IL6RB_HUMAN | P40189 from UniProtKB/Swiss-Prot  Length:918

    Alignment length:288
                                   332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602        
          IL6RB_HUMAN   323 EDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT 610
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eeee.--.....eeeeeeee...hhhhhh....eeeeeeee....eeeeee...eeeeeee...eeeeeeee........eeeee...........eeeeeeee..eeeeeee.......eeeeeeee.........eeeeee....eee.........eeeeeeeee........eeeeee............eeeee....eeee....hhhhhh....eeeeeee......eeeee.....eeee.......eeeeeeeee....eee...eeee. Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------------------------------------V-----------------I--------------------------------------T--------------------------------------------I--------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------------------------------------I--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) FN----FN3  PDB: B:307-402 UniProt: 329-424                                                            -FN3  PDB: B:404-495 UniProt: 426-517                                                        FN3  PDB: B:496-588 UniProt: 518-613                                                          PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------HEMATOPO_REC_L_F2  PDB: B:382-435 UniProt: 404-457    --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) --Exon 1.10 UniProt: 325-352  Exon 1.11a  PDB: B:331-401 UniProt: 353-423                            ------------------------------------------------------------Exon 1.13  PDB: B:462-496          ------------------------------------------------Exon 1.15a  PDB: B:545-588 UniProt: 567-614  Transcript 1 (1)
           Transcript 1 (2) 1.8-------------------------------------------------------------------------------------------------Exon 1.12  PDB: B:401-462 UniProt: 423-484                    ---------------------------------Exon 1.14  PDB: B:496-545 UniProt: 518-567        ------------------------------------------- Transcript 1 (2)
                 3l5j B 301 EDRPSKAPSFWYKI--SHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTT 588
                                   310   |  |320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580        
                                       314  |                                                                                                                                                                                                                                                                               
                                          317

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3L5J)

(no "CATH Domain" information available for 3L5J)

(no "Pfam Domain" information available for 3L5J)

Asymmetric Unit(hide GO term definitions)

Chain A,B (IL6RB_HUMAN | P40189)

molecular function
	GO:0004897	ciliary neurotrophic factor receptor activity	Combining with ciliary neurotrophic factor (CNTF) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005127	ciliary neurotrophic factor receptor binding	Interacting selectively and non-covalently with the ciliary neurotrophic factor receptor.
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0019838	growth factor binding	Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
	GO:0019970	interleukin-11 binding	Interacting selectively and non-covalently with interleukin-11.
	GO:0004921	interleukin-11 receptor activity	Combining with interleukin-11 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0045509	interleukin-27 receptor activity	Combining with interleukin-27 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0019981	interleukin-6 binding	Interacting selectively and non-covalently with interleukin-6.
	GO:0004915	interleukin-6 receptor activity	Combining with interleukin-6 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005138	interleukin-6 receptor binding	Interacting selectively and non-covalently with the interleukin-6 receptor.
	GO:0004923	leukemia inhibitory factor receptor activity	Combining with leukemia inhibitory factor (LIF) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0004924	oncostatin-M receptor activity	Combining with oncostatin-M and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	A series of molecular signals initiated by the binding of a ciliary neurotrophic factor (CNTF) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0005977	glycogen metabolic process	The chemical reactions and pathways involving glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues in alpha-(1->4) glycosidic linkage, joined together by alpha-(1->6) glycosidic linkages.
	GO:0038154	interleukin-11-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-11 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0070106	interleukin-27-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-27 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0070102	interleukin-6-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-6 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0048861	leukemia inhibitory factor signaling pathway	Any series of molecular signals initiated by the binding of leukemia inhibitory factor to a receptor on the surface of the target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0070104	negative regulation of interleukin-6-mediated signaling pathway	Any process that decreases the rate, frequency or extent of the series of molecular events generated as a consequence of interleukin-6 binding to a cell surface receptor.
	GO:0038165	oncostatin-M-mediated signaling pathway	A series of molecular signals initiated by the binding of oncostatin-M (OSM) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. OSM can signal via at least two different receptors (a specific receptor and a LIF receptor) to activate different downstream signal transduction pathways.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0002675	positive regulation of acute inflammatory response	Any process that activates or increases the frequency, rate, or extent of an acute inflammatory response.
	GO:0002821	positive regulation of adaptive immune response	Any process that activates or increases the frequency, rate, or extent of an adaptive immune response.
	GO:0048711	positive regulation of astrocyte differentiation	Any process that activates or increases the frequency, rate or extent of astrocyte differentiation.
	GO:0010613	positive regulation of cardiac muscle hypertrophy	Any process that increases the rate, frequency or extent of the enlargement or overgrowth of all or part of the heart due to an increase in size (not length) of individual cardiac muscle fibers, without cell division.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045669	positive regulation of osteoblast differentiation	Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
	GO:0010575	positive regulation of vascular endothelial growth factor production	Any process that increases or activates the frequency, rate, or extent of production of vascular endothelial growth factor.
	GO:0008593	regulation of Notch signaling pathway	Any process that modulates the frequency, rate or extent of the Notch signaling pathway.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0044297	cell body	The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
	GO:0070110	ciliary neurotrophic factor receptor complex	A protein complex that acts as a receptor for the cytokine ciliary neurotrophic factor (CNTF). In humans the receptor complex is a hexamer composed of two molecules each of CNTF and CNTFR and one molecule each of gp130 and LIFR.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005896	interleukin-6 receptor complex	A hexameric protein complex consisting of two molecules each of interleukin-6, interleukin-6 receptor alpha chain, and gp-130.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0005900	oncostatin-M receptor complex	A heterodimeric receptor for the cytokine oncostatin-M (OSM). In humans the receptor complex is made up of the gene products gp130 and OSMR-beta.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3l5j)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3l5j
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IL6RB_HUMAN \| P40189
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IL6RB_HUMAN \| P40189
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IL6RB_HUMAN \| P40189	:	1bj8 1bqu 1i1r 1n2q 1p9m 1pvh 3l5h 3l5i

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 5)

Sites (5, 5)

SS Bonds (3, 3)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 10)

PROSITE Motifs (2, 8)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (49, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File