Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF LEUKEMIA INHIBITORY FACTOR IN COMPLEX WITH GP130
 
Authors :  M. J. Boulanger, A. J. Bankovich, T. Kortemme, D. Baker, K. C. Garcia
Date :  27 Jun 03  (Deposition) - 14 Oct 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Cytokine, Receptor, Signaling, Beta Sheet, Four Helix Bundle, Signaling Protein/Cytokine Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. J. Boulanger, A. J. Bankovich, T. Kortemme, D. Baker, K. C. Garcia
Convergent Mechanisms For Recognition Of Divergent Cytokines By The Shared Signaling Receptor Gp130.
Mol. Cell V. 12 577 2003
PubMed-ID: 14527405  |  Reference-DOI: 10.1016/S1097-2765(03)00365-4
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INTERLEUKIN-6 RECEPTOR BETA CHAIN
    Chains: A, C
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Common: FALL ARMYWORM
    Expression System Taxid: 7108
    Fragment: DOMAINS D2 AND D3
    Gene: IL6ST
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IL-6R-BETA, INTERLEUKIN 6 SIGNAL TRANSDUCER, MEMBRANE GLYCOPROTEIN 130, GP130, ONCOSTATIN M RECEPTOR, CDW130, CD130 ANTIGEN
 
Molecule 2 - LEUKEMIA INHIBITORY FACTOR
    Chains: B, D
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Common: FALL ARMYWORM
    Expression System Taxid: 7108
    Gene: LIF OR HILDA
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: LIF, DIFFERENTIATION-STIMULATING FACTOR, D FACTOR, MELANOMA-DERIVED LPL INHIBITOR, MLPLI

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1IOD2Ligand/IonIODIDE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1IOD1Ligand/IonIODIDE ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1IOD1Ligand/IonIODIDE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:288BINDING SITE FOR RESIDUE IOD A 302
2AC2SOFTWARETRP C:288 , GLY D:140BINDING SITE FOR RESIDUE IOD D 202

(-) SS Bonds  (10, 10)

Asymmetric Unit
No.Residues
1A:112 -A:122
2A:150 -A:160
3B:12 -B:134
4B:18 -B:131
5B:60 -B:163
6C:112 -C:122
7C:150 -C:160
8D:12 -D:134
9D:18 -D:131
10D:60 -D:163

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Glu B:50 -Pro B:51
2Glu D:50 -Pro D:51

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 4)

Asymmetric Unit (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_047783G148RIL6RB_HUMANPolymorphism2228044A/CG126R
2UniProtVAR_074654A200GIL6RB_HUMANUnclassified199905033A/CA178G
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_047783G148RIL6RB_HUMANPolymorphism2228044AG126R
2UniProtVAR_074654A200GIL6RB_HUMANUnclassified199905033AA178G
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_047783G148RIL6RB_HUMANPolymorphism2228044CG126R
2UniProtVAR_074654A200GIL6RB_HUMANUnclassified199905033CA178G
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIF_OSMPS00590 LIF / OSM family signature.LIF_HUMAN173-192
 		  2B:151-170
D:151-170
2FN3PS50853 Fibronectin type-III domain profile.IL6RB_HUMAN224-324
 
518-613
426-517
329-424		  2A:202-301
C:202-301
-
-
-
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIF_OSMPS00590 LIF / OSM family signature.LIF_HUMAN173-192
 		  1B:151-170
-
2FN3PS50853 Fibronectin type-III domain profile.IL6RB_HUMAN224-324
 
518-613
426-517
329-424		  1A:202-301
-
-
-
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIF_OSMPS00590 LIF / OSM family signature.LIF_HUMAN173-192
 		  1-
D:151-170
2FN3PS50853 Fibronectin type-III domain profile.IL6RB_HUMAN224-324
 
518-613
426-517
329-424		  1-
C:202-301
-
-
-

(-) Exons   (7, 14)

Asymmetric Unit (7, 14)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002490751aENSE00001551728chr22:30642840-30642666175LIF_HUMAN1-770--
1.2ENST000002490752ENSE00000879785chr22:30640922-30640744179LIF_HUMAN7-66602B:12-44
D:12-44		33
33
1.3bENST000002490753bENSE00001215846chr22:30640050-306364363615LIF_HUMAN67-2021362B:45-180
D:45-180		136
136
2.1aENST000003812981aENSE00001488125chr5:55290772-55290612161IL6RB_HUMAN-00--
2.2aENST000003812982aENSE00001488122chr5:55278639-5527855288IL6RB_HUMAN-00--
2.3cENST000003812983cENSE00002172585chr5:55272121-5527204379IL6RB_HUMAN1-22220--
2.4bENST000003812984bENSE00000914155chr5:55265683-55265378306IL6RB_HUMAN22-1241032A:101-102
C:101-102		2
2
2.5ENST000003812985ENSE00000914153chr5:55264224-55264104121IL6RB_HUMAN124-164412A:102-142
C:102-142		41
41
2.6bENST000003812986bENSE00000914150chr5:55260140-55259974167IL6RB_HUMAN164-220572A:142-198
C:142-198		57
57
2.7ENST000003812987ENSE00000914147chr5:55259334-55259180155IL6RB_HUMAN220-271522A:198-249
C:198-249		52
52
2.8aENST000003812988aENSE00001006585chr5:55256389-55256230160IL6RB_HUMAN272-325542A:250-301
C:250-301		52
52
2.10ENST0000038129810ENSE00000914138chr5:55253119-5525303783IL6RB_HUMAN325-352280--
2.11aENST0000038129811aENSE00001745568chr5:55252063-55251853211IL6RB_HUMAN353-423710--
2.12ENST0000038129812ENSE00001685217chr5:55250820-55250638183IL6RB_HUMAN423-484620--
2.13ENST0000038129813ENSE00001781723chr5:55248179-55248078102IL6RB_HUMAN484-518350--
2.14ENST0000038129814ENSE00001750732chr5:55247903-55247757147IL6RB_HUMAN518-567500--
2.15aENST0000038129815aENSE00001667221chr5:55247432-55247292141IL6RB_HUMAN567-614480--
2.17dENST0000038129817dENSE00001743622chr5:55243417-5524332197IL6RB_HUMAN614-646330--
2.18ENST0000038129818ENSE00001611906chr5:55238579-5523849882IL6RB_HUMAN646-673280--
2.19eENST0000038129819eENSE00001488109chr5:55237647-552309236725IL6RB_HUMAN674-9182450--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:201
 aligned with IL6RB_HUMAN | P40189 from UniProtKB/Swiss-Prot  Length:918

    Alignment length:201
                                   132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322 
          IL6RB_HUMAN   123 GLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYE 323
               SCOP domains d1pvha1 A:101-196 Cytokine receptor gp130 cytokine-binding domains                              d1pvha2 A:197-301 Cytokine receptor gp130 cytokine-binding domains                                        SCOP domains
               CATH domains 1pvhA01 A:101-200 Immunoglobulins                                                                   1pvhA02 A:201-301 Immunoglobulins                                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeee.....eeeee.........eeeeeee........ee.......eee..........eeeeeeeee..eeee...eeehhhh.ee....eeeeee.......eeeeeee.hhhhhh..eeeeeeeee......ee.hhhhhh....eeeee......eeeeeeeeee.............eeee... Sec.struct. author
                 SAPs(SNPs) -------------------------R---------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------FN3  PDB: A:202-301 UniProt: 224-324                                                                 PROSITE
           Transcript 2 (1) 2.---------------------------------------Exon 2.6b  PDB: A:142-198 UniProt: 164-220               ---------------------------------------------------Exon 2.8a  PDB: A:250-301 UniProt: 272-325           Transcript 2 (1)
           Transcript 2 (2) -Exon 2.5  PDB: A:102-142 UniProt: 124-164-------------------------------------------------------Exon 2.7  PDB: A:198-249 UniProt: 220-271           ---------------------------------------------------- Transcript 2 (2)
                 1pvh A 101 GLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYE 301
                                   110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300 


Chain B from PDB  Type:PROTEIN  Length:169
 aligned with LIF_HUMAN | P15018 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:169
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193         
            LIF_HUMAN    34 CAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF 202
               SCOP domains d1pvhb_ B: Leukemia inhibitory factor (LIF)                                                                                                                               SCOP domains
               CATH domains 1pvhB00 B:12-180  [code=1.20.1250.10, no name defined]                                                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------LIF_OSM             ---------- PROSITE
               Transcript 1 Exon 1.2  PDB: B:12-44           Exon 1.3b  PDB: B:45-180 UniProt: 67-202                                                                                                 Transcript 1
                 1pvh B  12 CAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF 180
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171         


Chain C from PDB  Type:PROTEIN  Length:201
 aligned with IL6RB_HUMAN | P40189 from UniProtKB/Swiss-Prot  Length:918

    Alignment length:201
                                   132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322 
          IL6RB_HUMAN   123 GLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYE 323
               SCOP domains d1pvhc1 C:101-196 Cytokine receptor gp130 cytokine-binding domains                              d1pvhc2 C:197-301 Cytokine receptor gp130 cytokine-binding domains                                        SCOP domains
               CATH domains 1pvhC01 C:101-200 Immunoglobulins                                                                   1pvhC02 C:201-301 Immunoglobulins                                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeee.....eeeee.........eeeeeeee..ee...ee.......eee..........eeeeeeeee..eeee...eeehhhh.ee....eeeeee.......eeeeeee.hhhhhh..eeeeeeeee......ee.hhhhhh....eeeee......eeeeeeeeee.............eeee... Sec.struct. author
                 SAPs(SNPs) -------------------------R---------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------FN3  PDB: C:202-301 UniProt: 224-324                                                                 PROSITE
           Transcript 2 (1) 2.---------------------------------------Exon 2.6b  PDB: C:142-198 UniProt: 164-220               ---------------------------------------------------Exon 2.8a  PDB: C:250-301 UniProt: 272-325           Transcript 2 (1)
           Transcript 2 (2) -Exon 2.5  PDB: C:102-142 UniProt: 124-164-------------------------------------------------------Exon 2.7  PDB: C:198-249 UniProt: 220-271           ---------------------------------------------------- Transcript 2 (2)
                 1pvh C 101 GLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYE 301
                                   110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300 


Chain D from PDB  Type:PROTEIN  Length:169
 aligned with LIF_HUMAN | P15018 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:169
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193         
            LIF_HUMAN    34 CAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF 202
               SCOP domains d1pvhd_ D: Leukemia inhibitory factor (LIF)                                                                                                                               SCOP domains
               CATH domains 1pvhD00 D:12-180  [code=1.20.1250.10, no name defined]                                                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------LIF_OSM             ---------- PROSITE
               Transcript 1 Exon 1.2  PDB: D:12-44           Exon 1.3b  PDB: D:45-180 UniProt: 67-202                                                                                                 Transcript 1
                 1pvh D  12 CAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF 180
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1PVH)

(-) Gene Ontology  (95, 101)

Asymmetric Unit(hide GO term definitions)
Chain A,C   (IL6RB_HUMAN | P40189)
molecular function
    GO:0004897    ciliary neurotrophic factor receptor activity    Combining with ciliary neurotrophic factor (CNTF) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0005127    ciliary neurotrophic factor receptor binding    Interacting selectively and non-covalently with the ciliary neurotrophic factor receptor.
    GO:0004896    cytokine receptor activity    Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0019838    growth factor binding    Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
    GO:0019970    interleukin-11 binding    Interacting selectively and non-covalently with interleukin-11.
    GO:0004921    interleukin-11 receptor activity    Combining with interleukin-11 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0045509    interleukin-27 receptor activity    Combining with interleukin-27 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0019981    interleukin-6 binding    Interacting selectively and non-covalently with interleukin-6.
    GO:0004915    interleukin-6 receptor activity    Combining with interleukin-6 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0005138    interleukin-6 receptor binding    Interacting selectively and non-covalently with the interleukin-6 receptor.
    GO:0004923    leukemia inhibitory factor receptor activity    Combining with leukemia inhibitory factor (LIF) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0004924    oncostatin-M receptor activity    Combining with oncostatin-M and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
    GO:0070120    ciliary neurotrophic factor-mediated signaling pathway    A series of molecular signals initiated by the binding of a ciliary neurotrophic factor (CNTF) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0005977    glycogen metabolic process    The chemical reactions and pathways involving glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues in alpha-(1->4) glycosidic linkage, joined together by alpha-(1->6) glycosidic linkages.
    GO:0038154    interleukin-11-mediated signaling pathway    A series of molecular signals initiated by the binding of interleukin-11 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0070106    interleukin-27-mediated signaling pathway    A series of molecular signals initiated by the binding of interleukin-27 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0070102    interleukin-6-mediated signaling pathway    A series of molecular signals initiated by the binding of interleukin-6 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0048861    leukemia inhibitory factor signaling pathway    Any series of molecular signals initiated by the binding of leukemia inhibitory factor to a receptor on the surface of the target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0070104    negative regulation of interleukin-6-mediated signaling pathway    Any process that decreases the rate, frequency or extent of the series of molecular events generated as a consequence of interleukin-6 binding to a cell surface receptor.
    GO:0038165    oncostatin-M-mediated signaling pathway    A series of molecular signals initiated by the binding of oncostatin-M (OSM) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. OSM can signal via at least two different receptors (a specific receptor and a LIF receptor) to activate different downstream signal transduction pathways.
    GO:0042102    positive regulation of T cell proliferation    Any process that activates or increases the rate or extent of T cell proliferation.
    GO:0002675    positive regulation of acute inflammatory response    Any process that activates or increases the frequency, rate, or extent of an acute inflammatory response.
    GO:0002821    positive regulation of adaptive immune response    Any process that activates or increases the frequency, rate, or extent of an adaptive immune response.
    GO:0048711    positive regulation of astrocyte differentiation    Any process that activates or increases the frequency, rate or extent of astrocyte differentiation.
    GO:0010613    positive regulation of cardiac muscle hypertrophy    Any process that increases the rate, frequency or extent of the enlargement or overgrowth of all or part of the heart due to an increase in size (not length) of individual cardiac muscle fibers, without cell division.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0045669    positive regulation of osteoblast differentiation    Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
    GO:0010575    positive regulation of vascular endothelial growth factor production    Any process that increases or activates the frequency, rate, or extent of production of vascular endothelial growth factor.
    GO:0008593    regulation of Notch signaling pathway    Any process that modulates the frequency, rate or extent of the Notch signaling pathway.
    GO:0034097    response to cytokine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0044297    cell body    The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
    GO:0070110    ciliary neurotrophic factor receptor complex    A protein complex that acts as a receptor for the cytokine ciliary neurotrophic factor (CNTF). In humans the receptor complex is a hexamer composed of two molecules each of CNTF and CNTFR and one molecule each of gp130 and LIFR.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005896    interleukin-6 receptor complex    A hexameric protein complex consisting of two molecules each of interleukin-6, interleukin-6 receptor alpha chain, and gp-130.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005900    oncostatin-M receptor complex    A heterodimeric receptor for the cytokine oncostatin-M (OSM). In humans the receptor complex is made up of the gene products gp130 and OSMR-beta.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B,D   (LIF_HUMAN | P15018)
molecular function
    GO:0005125    cytokine activity    Functions to control the survival, growth, differentiation and effector function of tissues and cells.
    GO:0008083    growth factor activity    The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
    GO:0005146    leukemia inhibitory factor receptor binding    Interacting selectively and non-covalently with the leukemia inhibitory factor receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0001135    transcription factor activity, RNA polymerase II transcription factor recruiting    The function of binding to an RNA polymerase II (RNAP II) transcription factor and recruiting it to the transcription machinery complex in order to modulate transcription by RNAP II.
biological process
    GO:0031100    animal organ regeneration    The regrowth of a lost or destroyed animal organ.
    GO:0048708    astrocyte differentiation    The process in which a relatively unspecialized cell acquires the specialized features of an astrocyte. An astrocyte is the most abundant type of glial cell. Astrocytes provide support for neurons and regulate the environment in which they function.
    GO:0001974    blood vessel remodeling    The reorganization or renovation of existing blood vessels.
    GO:0046697    decidualization    The cellular and vascular changes occurring in the endometrium of the pregnant uterus just after the onset of blastocyst implantation. This process involves the proliferation and differentiation of the fibroblast-like endometrial stromal cells into large, polyploid decidual cells that eventually form the maternal component of the placenta.
    GO:0007566    embryo implantation    Attachment of the blastocyst to the uterine lining.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0048861    leukemia inhibitory factor signaling pathway    Any series of molecular signals initiated by the binding of leukemia inhibitory factor to a receptor on the surface of the target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0048286    lung alveolus development    The process whose specific outcome is the progression of the alveolus over time, from its formation to the mature structure. The alveolus is a sac for holding air in the lungs; formed by the terminal dilation of air passageways.
    GO:0030324    lung development    The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
    GO:0060463    lung lobe morphogenesis    The process in which the anatomical structures of a lung lobe are generated and organized. A lung lobe is a projection that extends from the lung.
    GO:0060426    lung vasculature development    The biological process whose specific outcome is the progression of a lung vasculature from an initial condition to its mature state. This process begins with the formation of the lung vasculature and ends with the mature structure. The lung vasculature is composed of the tubule structures that carry blood or lymph in the lungs.
    GO:0060135    maternal process involved in female pregnancy    A reproductive process occurring in the mother that allows an embryo or fetus to develop within it.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0048644    muscle organ morphogenesis    The process in which the anatomical structures of muscle are generated and organized.
    GO:0070373    negative regulation of ERK1 and ERK2 cascade    Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0016525    negative regulation of angiogenesis    Any process that stops, prevents, or reduces the frequency, rate or extent of angiogenesis.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0046888    negative regulation of hormone secretion    Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of a hormone from a cell.
    GO:0045835    negative regulation of meiotic nuclear division    Any process that stops, prevents, or reduces the frequency, rate or extent of meiosis.
    GO:0048666    neuron development    The process whose specific outcome is the progression of a neuron over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell.
    GO:0043410    positive regulation of MAPK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
    GO:0048711    positive regulation of astrocyte differentiation    Any process that activates or increases the frequency, rate or extent of astrocyte differentiation.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0051461    positive regulation of corticotropin secretion    Any process that activates or increases the frequency, rate or extent of the regulated release of corticotropin hormone from a cell.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:1901676    positive regulation of histone H3-K27 acetylation    Any process that activates or increases the frequency, rate or extent of histone H3-K27 acetylation.
    GO:0045651    positive regulation of macrophage differentiation    Any process that activates or increases the frequency, rate or extent of macrophage differentiation.
    GO:0072108    positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis    Any process that increases the rate, frequency or extent of the transition where a mesenchymal cell establishes apical/basolateral polarity, forms intercellular adhesive junctions, synthesizes basement membrane components and becomes an epithelial cell that will contribute to the shaping of the metanephros.
    GO:0010976    positive regulation of neuron projection development    Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0033138    positive regulation of peptidyl-serine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
    GO:0033141    positive regulation of peptidyl-serine phosphorylation of STAT protein    Any process that activates or increases the frequency, rate or extent of the phosphorylation of a serine residue of a STAT (Signal Transducer and Activator of Transcription) protein.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:1900182    positive regulation of protein localization to nucleus    Any process that activates or increases the frequency, rate or extent of protein localization to nucleus.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:1903025    regulation of RNA polymerase II regulatory region sequence-specific DNA binding    Any process that modulates the frequency, rate or extent of RNA polymerase II regulatory region sequence-specific DNA binding.
    GO:0045595    regulation of cell differentiation    Any process that modulates the frequency, rate or extent of cell differentiation, the process in which relatively unspecialized cells acquire specialized structural and functional features.
    GO:0072307    regulation of metanephric nephron tubule epithelial cell differentiation    Any process that modulates the frequency, rate or extent of metanephric nephron tubule epithelial cell differentiation.
    GO:0060041    retina development in camera-type eye    The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
    GO:0060708    spongiotrophoblast differentiation    The process in which a relatively unspecialized cell of the ectoplacental cone acquires specialized features of a spongiotrophoblast of the placenta. A spongiotrophoblast cell is a basophilic cell.
    GO:0048863    stem cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a stem cell. A stem cell is a cell that retains the ability to divide and proliferate throughout life to provide progenitor cells that can differentiate into specialized cells.
    GO:0019827    stem cell population maintenance    The process by which an organism or tissue maintains a population of stem cells of a single type. This can be achieved by a number of mechanisms: stem cell asymmetric division maintains stem cell numbers; stem cell symmetric division increases them; maintenance of a stem cell niche maintains the conditions for commitment to the stem cell fate for some types of stem cell; stem cells may arise de novo from other cell types.
    GO:0060290    transdifferentiation    The conversion of a differentiated cell of one fate into a differentiated cell of another fate without first undergoing cell division or reversion to a more primitive or stem cell-like fate.
    GO:0060707    trophoblast giant cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a trophoblast giant cell of the placenta. Trophoblast giant cells are the cell of the placenta that line the maternal decidua.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    IOD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu B:50 - Pro B:51   [ RasMol ]  
    Glu D:50 - Pro D:51   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pvh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IL6RB_HUMAN | P40189
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  LIF_HUMAN | P15018
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IL6RB_HUMAN | P40189
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  LIF_HUMAN | P15018
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IL6RB_HUMAN | P40189: 1bj8 1bqu 1i1r 1n2q 1p9m 3l5h 3l5i 3l5j
        LIF_HUMAN | P15018: 1emr 2q7n

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PVH)