1I1R - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF A CYTOKINE/RECEPTOR COMPLEX

Authors :   D. Chow, X. He, A. L. Snow, S. Rose-John, K. C. Garcia

Date :   02 Feb 01 (Deposition) - 28 Mar 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Cytokine/Receptor Complex, Gp130, Viral Il-6, Crystal Structure (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. Chow, X. He, A. L. Snow, S. Rose-John, K. C. Garcia
Structure Of An Extracellular Gp130 Cytokine Receptor Signaling Complex.
Science V. 291 2150 2001
PubMed-ID: 11251120 | Reference-DOI: 10.1126/SCIENCE.1058308
(for further references see the PDB file header)

Molecule 1 - INTERLEUKIN-6 RECEPTOR BETA CHAIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cell Line	:	SF9
	Expression System Common	:	FALL ARMYWORM
	Expression System Plasmid	:	PACGP67A
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	DOMAINS 1, 2, 3 OF THE GP130 EXTRACELLULAR DOMAIN (RESIDUES 1-303)
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	EXPRESSED IN THE PRESENCE OF INHIBITOR OF N- LINKED GLYCOSYLATION (TUNICAMYCIN)
	Synonym	:	GP130

Molecule 2 - VIRAL IL-6
	Chains	:	B
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cell Line	:	SF9
	Expression System Common	:	FALL ARMYWORM
	Expression System Plasmid	:	PACGP67A
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULOVIRUS
	Organism Scientific	:	HUMAN HERPESVIRUS 8
	Organism Taxid	:	37296
	Other Details	:	NON-GLYCOSYLATED
	Synonym	:	FUNCTIONAL INTERLEUKIN-6 HOMOLOG

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1I1R)

(no "Site" information available for 1I1R)

Asymmetric Unit

No.	Residues
1	A:6	-	A:32
2	A:26	-	A:81
3	A:112	-	A:122
4	A:150	-	A:160
5	B:31	-	B:37
6	B:60	-	B:70

Asymmetric Unit

No.	Residues
1	Ser A:10	-	Pro A:11

Asymmetric Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_047783	G	148	R	IL6RB_HUMAN	Polymorphism	2228044	A	G	126	R
2	UniProt	VAR_074654	A	200	G	IL6RB_HUMAN	Unclassified	199905033	A	A	178	G

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_047783	G	148	R	IL6RB_HUMAN	Polymorphism	2228044	A	G	126	R
2	UniProt	VAR_074654	A	200	G	IL6RB_HUMAN	Unclassified	199905033	A	A	178	G

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	IL6RB_HUMAN	224-324 518-613 426-517 329-424	1	A:202-302 - - -

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FN3	PS50853	Fibronectin type-III domain profile.	IL6RB_HUMAN	224-324 518-613 426-517 329-424	2	A:202-302 - - -

Asymmetric Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000381298	1a	ENSE00001488125	chr5:55290772-55290612	161	IL6RB_HUMAN	-	0	0	-	-
1.2a	ENST00000381298	2a	ENSE00001488122	chr5:55278639-55278552	88	IL6RB_HUMAN	-	0	0	-	-
1.3c	ENST00000381298	3c	ENSE00002172585	chr5:55272121-55272043	79	IL6RB_HUMAN	1-22	22	0	-	-
1.4b	ENST00000381298	4b	ENSE00000914155	chr5:55265683-55265378	306	IL6RB_HUMAN	22-124	103	1	A:2-102	101
1.5	ENST00000381298	5	ENSE00000914153	chr5:55264224-55264104	121	IL6RB_HUMAN	124-164	41	1	A:102-142	41
1.6b	ENST00000381298	6b	ENSE00000914150	chr5:55260140-55259974	167	IL6RB_HUMAN	164-220	57	1	A:142-198	57
1.7	ENST00000381298	7	ENSE00000914147	chr5:55259334-55259180	155	IL6RB_HUMAN	220-271	52	1	A:198-249	52
1.8a	ENST00000381298	8a	ENSE00001006585	chr5:55256389-55256230	160	IL6RB_HUMAN	272-325	54	1	A:250-302	53
1.10	ENST00000381298	10	ENSE00000914138	chr5:55253119-55253037	83	IL6RB_HUMAN	325-352	28	0	-	-
1.11a	ENST00000381298	11a	ENSE00001745568	chr5:55252063-55251853	211	IL6RB_HUMAN	353-423	71	0	-	-
1.12	ENST00000381298	12	ENSE00001685217	chr5:55250820-55250638	183	IL6RB_HUMAN	423-484	62	0	-	-
1.13	ENST00000381298	13	ENSE00001781723	chr5:55248179-55248078	102	IL6RB_HUMAN	484-518	35	0	-	-
1.14	ENST00000381298	14	ENSE00001750732	chr5:55247903-55247757	147	IL6RB_HUMAN	518-567	50	0	-	-
1.15a	ENST00000381298	15a	ENSE00001667221	chr5:55247432-55247292	141	IL6RB_HUMAN	567-614	48	0	-	-
1.17d	ENST00000381298	17d	ENSE00001743622	chr5:55243417-55243321	97	IL6RB_HUMAN	614-646	33	0	-	-
1.18	ENST00000381298	18	ENSE00001611906	chr5:55238579-55238498	82	IL6RB_HUMAN	646-673	28	0	-	-
1.19e	ENST00000381298	19e	ENSE00001488109	chr5:55237647-55230923	6725	IL6RB_HUMAN	674-918	245	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:301
 aligned with IL6RB_HUMAN | P40189 from UniProtKB/Swiss-Prot  Length:918

    Alignment length:301
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323 
          IL6RB_HUMAN    24 LLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYED 324
               SCOP domains d1i1ra1 A:2-101 Cytokine receptor gp130 cytokine-binding domains                                    d1i1ra2 A:102-196 Cytokine receptor gp130 cytokine-binding domains                             d1i1ra3 A:197-302 Cytokine receptor gp130 cytokine-binding domains                                         SCOP domains
               CATH domains 1i1rA01 A:2-101 Immunoglobulins                                                                     1i1rA02 A:102-201 Immunoglobulins                                                                   1i1rA03 A:202-302 Immunoglobulins                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....eee....eeeeeeehhhhhhhhh.hhh.eeeee..ee.hhhhheeee..eeeeee......eeeeeeeeee...eeeeeeeeeeeee......eeeeeeee.....eeeee.........eeeeeeee..ee...ee.......eee..........eeeeeeeee..eeee...eeehhhh.ee....eeeeee........eeeeee.hhhhhh..eeeeeeeee......ee.hhhhhh....eeee.......eeeeeeeeee.............eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------R---------------------------------------------------G---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FN3  PDB: A:202-302 UniProt: 224-324                                                                  PROSITE
           Transcript 1 (1) Exon 1.4b  PDB: A:2-102 UniProt: 22-124 [INCOMPLETE]                                                 ---------------------------------------Exon 1.6b  PDB: A:142-198 UniProt: 164-220               ---------------------------------------------------Exon 1.8a  PDB: A:250-302 UniProt: 272-325            Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------Exon 1.5  PDB: A:102-142 UniProt: 124-164-------------------------------------------------------Exon 1.7  PDB: A:198-249 UniProt: 220-271           ----------------------------------------------------- Transcript 1 (2)
                 1i1r A   2 LLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYED 302
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301

Chain B from PDB  Type:PROTEIN  Length:167
 aligned with Q98823_HHV8 | Q98823 from UniProtKB/TrEMBL  Length:204

    Alignment length:167
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       
          Q98823_HHV8    29 EFEKDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLDSIP 195
               SCOP domains d1i1rb_ B: Interleukin-6                                                                                                                                                SCOP domains
               CATH domains 1i1rB00 B:6-172  [code=1.20.1250.10, no name defined]                                                                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhh..............................hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1i1r B   6 EFEKDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLDSIP 172
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Growth Hormone; Chain: A; (136)

Homologous Superfamily: [code=1.20.1250.10, no name defined] (130)

Human (Homo sapiens) (110)

1i1rB00

B:6-172

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

Human (Homo sapiens) (912)

2a	1i1rA03	A:202-302
2b	1i1rA02	A:102-201
2c	1i1rA01	A:2-101

(no "Pfam Domain" information available for 1I1R)

Asymmetric Unit(hide GO term definitions)

Chain A (IL6RB_HUMAN | P40189)

molecular function
	GO:0004897	ciliary neurotrophic factor receptor activity	Combining with ciliary neurotrophic factor (CNTF) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005127	ciliary neurotrophic factor receptor binding	Interacting selectively and non-covalently with the ciliary neurotrophic factor receptor.
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0019838	growth factor binding	Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
	GO:0019970	interleukin-11 binding	Interacting selectively and non-covalently with interleukin-11.
	GO:0004921	interleukin-11 receptor activity	Combining with interleukin-11 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0045509	interleukin-27 receptor activity	Combining with interleukin-27 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0019981	interleukin-6 binding	Interacting selectively and non-covalently with interleukin-6.
	GO:0004915	interleukin-6 receptor activity	Combining with interleukin-6 and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005138	interleukin-6 receptor binding	Interacting selectively and non-covalently with the interleukin-6 receptor.
	GO:0004923	leukemia inhibitory factor receptor activity	Combining with leukemia inhibitory factor (LIF) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0004924	oncostatin-M receptor activity	Combining with oncostatin-M and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	A series of molecular signals initiated by the binding of a ciliary neurotrophic factor (CNTF) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0005977	glycogen metabolic process	The chemical reactions and pathways involving glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues in alpha-(1->4) glycosidic linkage, joined together by alpha-(1->6) glycosidic linkages.
	GO:0038154	interleukin-11-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-11 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0070106	interleukin-27-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-27 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0070102	interleukin-6-mediated signaling pathway	A series of molecular signals initiated by the binding of interleukin-6 to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0048861	leukemia inhibitory factor signaling pathway	Any series of molecular signals initiated by the binding of leukemia inhibitory factor to a receptor on the surface of the target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0070104	negative regulation of interleukin-6-mediated signaling pathway	Any process that decreases the rate, frequency or extent of the series of molecular events generated as a consequence of interleukin-6 binding to a cell surface receptor.
	GO:0038165	oncostatin-M-mediated signaling pathway	A series of molecular signals initiated by the binding of oncostatin-M (OSM) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription. OSM can signal via at least two different receptors (a specific receptor and a LIF receptor) to activate different downstream signal transduction pathways.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0002675	positive regulation of acute inflammatory response	Any process that activates or increases the frequency, rate, or extent of an acute inflammatory response.
	GO:0002821	positive regulation of adaptive immune response	Any process that activates or increases the frequency, rate, or extent of an adaptive immune response.
	GO:0048711	positive regulation of astrocyte differentiation	Any process that activates or increases the frequency, rate or extent of astrocyte differentiation.
	GO:0010613	positive regulation of cardiac muscle hypertrophy	Any process that increases the rate, frequency or extent of the enlargement or overgrowth of all or part of the heart due to an increase in size (not length) of individual cardiac muscle fibers, without cell division.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045669	positive regulation of osteoblast differentiation	Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
	GO:0010575	positive regulation of vascular endothelial growth factor production	Any process that increases or activates the frequency, rate, or extent of production of vascular endothelial growth factor.
	GO:0008593	regulation of Notch signaling pathway	Any process that modulates the frequency, rate or extent of the Notch signaling pathway.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0044297	cell body	The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
	GO:0070110	ciliary neurotrophic factor receptor complex	A protein complex that acts as a receptor for the cytokine ciliary neurotrophic factor (CNTF). In humans the receptor complex is a hexamer composed of two molecules each of CNTF and CNTFR and one molecule each of gp130 and LIFR.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005896	interleukin-6 receptor complex	A hexameric protein complex consisting of two molecules each of interleukin-6, interleukin-6 receptor alpha chain, and gp-130.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0005900	oncostatin-M receptor complex	A heterodimeric receptor for the cytokine oncostatin-M (OSM). In humans the receptor complex is made up of the gene products gp130 and OSMR-beta.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (Q98823_HHV8 | Q98823)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0005138	interleukin-6 receptor binding	Interacting selectively and non-covalently with the interleukin-6 receptor.
biological process
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1i1r)

	Sites
(no "Sites" information available for 1i1r)

	Cis Peptide Bonds
		Ser A:10 - Pro A:11	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1i1r
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IL6RB_HUMAN \| P40189
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q98823_HHV8 \| Q98823
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IL6RB_HUMAN \| P40189
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q98823_HHV8 \| Q98823
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IL6RB_HUMAN \| P40189	:	1bj8 1bqu 1n2q 1p9m 1pvh 3l5h 3l5i 3l5j

(no "Related Entries Specified in the PDB File" available for 1I1R)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (6, 6)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (1, 1)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (51, 53)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File