|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 11)
Asymmetric Unit (4, 11)
|
Sites (11, 11)
Asymmetric Unit (11, 11)
|
SS Bonds (8, 8)
Asymmetric Unit
|
||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3GSH) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3GSH) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:91 aligned with NLTP1_HORVU | P07597 from UniProtKB/Swiss-Prot Length:117 Alignment length:91 36 46 56 66 76 86 96 106 116 NLTP1_HORVU 27 LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY 117 SCOP domains d3gsha_ A: Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) SCOP domains CATH domains 3gshA00 A:1-91 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------PLANT_LTP PDB: A:69-9- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 3gsh A 1 LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY 91 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:91 aligned with NLTP1_HORVU | P07597 from UniProtKB/Swiss-Prot Length:117 Alignment length:91 36 46 56 66 76 86 96 106 116 NLTP1_HORVU 27 LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY 117 SCOP domains d3gshb_ B: Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) SCOP domains CATH domains 3gshB00 B:1-91 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------PLANT_LTP PDB: B:69-9- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 3gsh B 1 LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY 91 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3GSH) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A,B (NLTP1_HORVU | P07597)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|