|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
NMR Structure (2, 2) NMR Structure * (2, 2) |
NMR Structure (2, 2)
|
NMR Structure
|
NMR Structure
|
(no "SAP(SNP)/Variant" information available for 1JTB) |
NMR Structure (1, 1)
|
(no "Exon" information available for 1JTB) |
NMR StructureChain A from PDB Type:PROTEIN Length:91 aligned with NLTP1_HORVU | P07597 from UniProtKB/Swiss-Prot Length:117 Alignment length:91 36 46 56 66 76 86 96 106 116 NLTP1_HORVU 27 LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY 117 SCOP domains d1jtba_ A: Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) SCOP domains CATH domains 1jtbA00 A:1-91 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains Tryp_alpha_amyl-1jtbA01 A:1-87 ---- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------PLANT_LTP PDB: A:69-9- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 1jtb A 1 LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY 91 10 20 30 40 50 60 70 80 90
|
NMR Structure |
NMR Structure
|
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A (NLTP1_HORVU | P07597)
|
|
|
|
|
|
|