3FWV - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF A REDESIGNED TPR PROTEIN, T-MOD(VMY), IN COMPLEX WITH MEEVF PEPTIDE

Authors :   M. E. Jackrel, R. Valverde, L. Regan

Date :   19 Jan 09 (Deposition) - 21 Apr 09 (Release) - 10 Aug 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Tetratricopeptide Repeat Protein (Tpr), Protein-Peptide Complex, Designed Protein, Tpr, Nucleus, Phosphoprotein, Tpr Repeat, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. E. Jackrel, R. Valverde, L. Regan
Redesign Of A Protein-Peptide Interaction: Characterization And Applications
Protein Sci. V. 18 762 2009
PubMed-ID: 19309728 | Reference-DOI: 10.1002/PRO.75

Molecule 1 - HSC70/HSP90-ORGANIZING PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PPROEX-HTA
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	TPR REPEATS 4-6
	Gene	:	STIP1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HOP, STRESS-INDUCED-PHOSPHOPROTEIN 1, STI1, TRANSFORMATION- SENSITIVE PROTEIN IEF SSP 3521, NY-REN-11 ANTIGEN

Molecule 2 - HEAT SHOCK PROTEIN HSP 90-BETA
	Chains	:	C, D
	Engineered	:	YES
	Fragment	:	C-TERMINAL RESIDUES
	Other Details	:	THE AUTHOR STATES THAT THE PEPTIDE IS A SYNTHETIC PEPTIDE BASED ON THE C-TERMINAL REGION OF THE HSP90 PROTEIN, BUT MUTATED FROM THE SEQUENCE MEEVD IN HOMO SAPIENS TO MEEVF.
	Synonym	:	HSP 90, HSP 84
	Synthetic	:	YES

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 6)

No.	Name	Count	Type	Full Name
1	ACE	2	Mod. Amino Acid	ACETYL GROUP
2	NI	4	Ligand/Ion	NICKEL (II) ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	ACE	1	Mod. Amino Acid	ACETYL GROUP
2	NI	-1	Ligand/Ion	NICKEL (II) ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	ACE	1	Mod. Amino Acid	ACETYL GROUP
2	NI	-1	Ligand/Ion	NICKEL (II) ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:36 , HOH A:188	BINDING SITE FOR RESIDUE NI A 3
2	AC2	SOFTWARE	HOH A:94 , HOH A:97 , HIS A:247 , HIS A:321 , LYS A:325	BINDING SITE FOR RESIDUE NI A 5
3	AC3	SOFTWARE	ARG B:297 , HIS B:330	BINDING SITE FOR RESIDUE NI B 2
4	AC4	SOFTWARE	HOH B:25 , HOH B:83 , HOH B:90 , HIS B:247 , HIS B:321 , LYS B:325	BINDING SITE FOR RESIDUE NI B 4

(no "SS Bond" information available for 3FWV)

(no "Cis Peptide Bond" information available for 3FWV)

(no "SAP(SNP)/Variant" information available for 3FWV)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TPR	PS50005	TPR repeat profile.	STIP1_HUMAN	4-37 38-71 72-105 225-258 259-292 300-333 360-393 394-427 428-461	6	- - - A:225-258 B:225-258 A:259-292 B:259-292 A:300-333 B:300-333 - - -
2	TPR_REGION	PS50293	TPR repeat region circular profile.	STIP1_HUMAN	4-105 225-461	2	- A:225-349 B:225-349

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TPR	PS50005	TPR repeat profile.	STIP1_HUMAN	4-37 38-71 72-105 225-258 259-292 300-333 360-393 394-427 428-461	3	- - - A:225-258 - A:259-292 - A:300-333 - - - -
2	TPR_REGION	PS50293	TPR repeat region circular profile.	STIP1_HUMAN	4-105 225-461	1	- A:225-349 -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TPR	PS50005	TPR repeat profile.	STIP1_HUMAN	4-37 38-71 72-105 225-258 259-292 300-333 360-393 394-427 428-461	3	- - - - B:225-258 - B:259-292 - B:300-333 - - -
2	TPR_REGION	PS50293	TPR repeat region circular profile.	STIP1_HUMAN	4-105 225-461	1	- - B:225-349

Asymmetric Unit (6, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2	ENST00000305218	2	ENSE00001303761	chr11:63953587-63953742	156	STIP1_HUMAN	1-3	3	0	-	-
1.3	ENST00000305218	3	ENSE00001292614	chr11:63960550-63960759	210	STIP1_HUMAN	4-73	70	0	-	-
1.4	ENST00000305218	4	ENSE00001196235	chr11:63961661-63961802	142	STIP1_HUMAN	74-121	48	0	-	-
1.5	ENST00000305218	5	ENSE00001196229	chr11:63961951-63962092	142	STIP1_HUMAN	121-168	48	0	-	-
1.6	ENST00000305218	6	ENSE00001196227	chr11:63963117-63963285	169	STIP1_HUMAN	168-224	57	2	A:222-224 B:222-224	3 3
1.7	ENST00000305218	7	ENSE00001139237	chr11:63964743-63964869	127	STIP1_HUMAN	225-267	43	2	A:225-267 B:225-267	43 43
1.8	ENST00000305218	8	ENSE00001139229	chr11:63964965-63965067	103	STIP1_HUMAN	267-301	35	2	A:267-301 B:267-301	35 35
1.9	ENST00000305218	9	ENSE00001139278	chr11:63965326-63965446	121	STIP1_HUMAN	301-341	41	2	A:301-341 B:301-341	41 41
1.10	ENST00000305218	10	ENSE00001310490	chr11:63967412-63967508	97	STIP1_HUMAN	342-374	33	2	A:342-349 B:342-349	8 8
1.11	ENST00000305218	11	ENSE00001317889	chr11:63967641-63967765	125	STIP1_HUMAN	374-415	42	0	-	-
1.12	ENST00000305218	12	ENSE00001169747	chr11:63970348-63970384	37	STIP1_HUMAN	416-428	13	0	-	-
1.13	ENST00000305218	13	ENSE00001169731	chr11:63970597-63970700	104	STIP1_HUMAN	428-462	35	0	-	-
1.14	ENST00000305218	14	ENSE00001169722	chr11:63970922-63971094	173	STIP1_HUMAN	463-520	58	0	-	-
1.15b	ENST00000305218	15b	ENSE00001518832	chr11:63971526-63972020	495	STIP1_HUMAN	520-543	24	0	-	-

2.1a	ENST00000371646	1a	ENSE00001361028	chr6:44214824-44214932	109	HS90B_HUMAN	-	0	0	-	-
2.3b	ENST00000371646	3b	ENSE00002201694	chr6:44216367-44216513	147	HS90B_HUMAN	1-49	49	0	-	-
2.4b	ENST00000371646	4b	ENSE00002189486	chr6:44217114-44217320	207	HS90B_HUMAN	50-118	69	0	-	-
2.5a	ENST00000371646	5a	ENSE00002183060	chr6:44217412-44217571	160	HS90B_HUMAN	119-172	54	0	-	-
2.6	ENST00000371646	6	ENSE00002150570	chr6:44217758-44217891	134	HS90B_HUMAN	172-216	45	0	-	-
2.7	ENST00000371646	7	ENSE00002189784	chr6:44218028-44218336	309	HS90B_HUMAN	217-319	103	0	-	-
2.8	ENST00000371646	8	ENSE00002147387	chr6:44218785-44218950	166	HS90B_HUMAN	320-375	56	0	-	-
2.9	ENST00000371646	9	ENSE00001140344	chr6:44219155-44219345	191	HS90B_HUMAN	375-438	64	0	-	-
2.10	ENST00000371646	10	ENSE00001140336	chr6:44219474-44219621	148	HS90B_HUMAN	439-488	50	0	-	-
2.11d	ENST00000371646	11d	ENSE00000974672	chr6:44219736-44220004	269	HS90B_HUMAN	488-577	90	2	C:0-5 D:0-5	6 6
2.12	ENST00000371646	12	ENSE00000974673	chr6:44220782-44221115	334	HS90B_HUMAN	578-689	112	0	-	-
2.13a	ENST00000371646	13a	ENSE00001427294	chr6:44221226-44221620	395	HS90B_HUMAN	689-724	36	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:128
 aligned with STIP1_HUMAN | P31948 from UniProtKB/Swiss-Prot  Length:543

    Alignment length:128
                                   231       241       251       261       271       281       291       301       311       321       331       341        
          STIP1_HUMAN   222 KKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ 349
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3fwvA00 A:222-349  [code=1.25.40.10, no name defined]                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---TPR  PDB: A:225-258               TPR  PDB: A:259-292               -------TPR  PDB: A:300-333               ---------------- PROSITE (1)
                PROSITE (2) ---TPR_REGION  PDB: A:225-349 UniProt: 225-461                                                                                   PROSITE (2)
           Transcript 1 (1) 1.6Exon 1.7  PDB: A:225-267 UniProt: 225-267  ---------------------------------Exon 1.9  PDB: A:301-341 UniProt: 301-3411.10     Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.8  PDB: A:267-301           ------------------------------------------------ Transcript 1 (2)
                 3fwv A 222 SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ 349
                                   231       241       251       261       271       281       291       301       311       321       331       341

Chain B from PDB  Type:PROTEIN  Length:128
 aligned with STIP1_HUMAN | P31948 from UniProtKB/Swiss-Prot  Length:543

    Alignment length:128
                                   231       241       251       261       271       281       291       301       311       321       331       341        
          STIP1_HUMAN   222 KKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ 349
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3fwvB00 B:222-349  [code=1.25.40.10, no name defined]                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---TPR  PDB: B:225-258               TPR  PDB: B:259-292               -------TPR  PDB: B:300-333               ---------------- PROSITE (1)
                PROSITE (2) ---TPR_REGION  PDB: B:225-349 UniProt: 225-461                                                                                   PROSITE (2)
           Transcript 1 (1) 1.6Exon 1.7  PDB: B:225-267 UniProt: 225-267  ---------------------------------Exon 1.9  PDB: B:301-341 UniProt: 301-3411.10     Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.8  PDB: B:267-301           ------------------------------------------------ Transcript 1 (2)
                 3fwv B 222 SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ 349
                                   231       241       251       261       271       281       291       301       311       321       331       341

Chain C from PDB  Type:PROTEIN  Length:6
 aligned with HS90B_HUMAN | P08238 from UniProtKB/Swiss-Prot  Length:724

    Alignment length:6
          HS90B_HUMAN   566 LMKEIL 571
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
               Transcript 2 2.11d  Transcript 2
                 3fwv C   0 xMEEVF   5
                            |     
                            |     
                            0-ACE

Chain D from PDB  Type:PROTEIN  Length:6
 aligned with HS90B_HUMAN | P08238 from UniProtKB/Swiss-Prot  Length:724

    Alignment length:6
          HS90B_HUMAN   566 LMKEIL 571
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
               Transcript 2 2.11d  Transcript 2
                 3fwv D   0 xMEEVF   5
                            |     
                            0-ACE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3FWV)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Alpha Horseshoe (399)

Topology: Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat (320)

Homologous Superfamily: [code=1.25.40.10, no name defined] (42)

Human (Homo sapiens) (17)

1a	3fwvA00	A:222-349
1b	3fwvB00	B:222-349

(no "Pfam Domain" information available for 3FWV)

Asymmetric Unit(hide GO term definitions)

Chain A,B (STIP1_HUMAN | P31948)

molecular function
	GO:0030544	Hsp70 protein binding	Interacting selectively and non-covalently with Hsp70 proteins, any of a group of heat shock proteins around 70kDa in size.
	GO:0051087	chaperone binding	Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
	GO:0008022	protein C-terminus binding	Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006950	response to stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain C,D (HS90B_HUMAN | P08238)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0002135	CTP binding	Interacting selectively and non-covalently with CTP, cytidine 5'-triphosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0023026	MHC class II protein complex binding	Interacting selectively and non-covalently with the class II major histocompatibility complex.
	GO:0030911	TPR domain binding	Interacting selectively and non-covalently with a tetratricopeptide repeat (TPR) domain of a protein, the consensus sequence of which is defined by a pattern of small and large hydrophobic amino acids and a structure composed of helices.
	GO:0002134	UTP binding	Interacting selectively and non-covalently with UTP, uridine 5'-triphosphate.
	GO:0032564	dATP binding	Interacting selectively and non-covalently with dATP, deoxyadenosine triphosphate.
	GO:0003725	double-stranded RNA binding	Interacting selectively and non-covalently with double-stranded RNA.
	GO:0042826	histone deacetylase binding	Interacting selectively and non-covalently with the enzyme histone deacetylase.
	GO:0044325	ion channel binding	Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
	GO:0019900	kinase binding	Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
	GO:0030235	nitric-oxide synthase regulator activity	Modulates the activity of nitric oxide synthase.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0019887	protein kinase regulator activity	Modulates the activity of a protein kinase, an enzyme which phosphorylates a protein.
	GO:0017098	sulfonylurea receptor binding	Interacting selectively and non-covalently with the sulfonylurea receptor, a regulatory subunit of the ATP-sensitive potassium ion channel.
	GO:0051082	unfolded protein binding	Interacting selectively and non-covalently with an unfolded protein.
biological process
	GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
	GO:0071353	cellular response to interleukin-4	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-4 stimulus.
	GO:0071407	cellular response to organic cyclic compound	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0043524	negative regulation of neuron apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
	GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0001890	placenta development	The process whose specific outcome is the progression of the placenta over time, from its formation to the mature structure. The placenta is an organ of metabolic interchange between fetus and mother, partly of embryonic origin and partly of maternal origin.
	GO:0045793	positive regulation of cell size	Any process that increases cell size.
	GO:0045429	positive regulation of nitric oxide biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of nitric oxide.
	GO:0032092	positive regulation of protein binding	Any process that activates or increases the frequency, rate or extent of protein binding.
	GO:0033160	positive regulation of protein import into nucleus, translocation	Any process that activates or increases the vectorial transfer of a protein from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0071902	positive regulation of protein serine/threonine kinase activity	Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0050821	protein stabilization	Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
	GO:1900034	regulation of cellular response to heat	Any process that modulates the frequency, rate or extent of cellular response to heat.
	GO:0060334	regulation of interferon-gamma-mediated signaling pathway	Any process that modulates the rate, frequency or extent of the series of molecular events generated as a consequence of interferon-gamma binding to a cell surface receptor.
	GO:0031396	regulation of protein ubiquitination	Any process that modulates the frequency, rate or extent of the addition of ubiquitin groups to a protein.
	GO:0060338	regulation of type I interferon-mediated signaling pathway	Any process that modulates the rate, frequency or extent of a type I interferon-mediated signaling pathway. A type I interferon-mediated signaling pathway is the series of molecular events generated as a consequence of a type I interferon binding to a cell surface receptor.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0009651	response to salt stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating an increase or decrease in the concentration of salt (particularly but not exclusively sodium and chloride ions) in the environment.
	GO:0006950	response to stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
	GO:0006986	response to unfolded protein	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an unfolded protein stimulus.
	GO:0097435	supramolecular fiber organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a supramolecular fiber, a polymer consisting of an indefinite number of protein or protein complex subunits that have polymerised to form a fiber-shaped structure.
	GO:0019062	virion attachment to host cell	The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
	GO:0008180	COP9 signalosome	A protein complex that catalyzes the deneddylation of proteins, including the cullin component of SCF ubiquitin E3 ligase; deneddylation increases the activity of cullin family ubiquitin ligases. The signalosome is involved in many regulatory process, including some which control development, in many species; also regulates photomorphogenesis in plants; in many species its subunits are highly similar to those of the proteasome.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0031526	brush border membrane	The portion of the plasma membrane surrounding the brush border.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016234	inclusion body	A discrete intracellular part formed of aggregated molecules such as proteins or other biopolymers.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0042470	melanosome	A tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored. Melanosomes are synthesized in melanocyte cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NI	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3fwv)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3fwv
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HS90B_HUMAN \| P08238
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	STIP1_HUMAN \| P31948
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HS90B_HUMAN \| P08238
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	STIP1_HUMAN \| P31948
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 3FWV)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Exons (6, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (63, 66)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File