|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3ETY) |
Sites (0, 0)| (no "Site" information available for 3ETY) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3ETY) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3ETY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ETY) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3ETY) |
Exons (0, 0)| (no "Exon" information available for 3ETY) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:104 aligned with Q5I6B0_FUSNU | Q5I6B0 from UniProtKB/TrEMBL Length:129 Alignment length:104 31 41 51 61 71 81 91 101 111 121 Q5I6B0_FUSNU 22 AASLVGELQALDAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEAEMEQQKAVISDFEKIQAL 125 SCOP domains -------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 3ety A 4 AASLVGELQAADAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEAEMEQQKAVISDFEKIQAL 107 13 23 33 43 53 63 73 83 93 103
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3ETY) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3ETY) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3ETY) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3ETY)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|