|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 6)
|
Asymmetric Unit (6, 6)
|
(no "SS Bond" information available for 2ZCZ) |
(no "Cis Peptide Bond" information available for 2ZCZ) |
(no "SAP(SNP)/Variant" information available for 2ZCZ) |
(no "PROSITE Motif" information available for 2ZCZ) |
(no "Exon" information available for 2ZCZ) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:73 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:73 74 14 24 34 44 54 64 74 MTRB_GEOSE 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK--- - SCOP domains d2zcza_ A: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2zczA00 A:7-79 [code=2.60.40.50, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 2zcz A 7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAA 79 16 26 36 46 56 66 76 Chain B from PDB Type:PROTEIN Length:69 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:69 12 22 32 42 52 62 MTRB_GEOSE 3 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESE 71 SCOP domains d2zczb_ B: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2zczB00 B:5-73 [code=2.60.40.50, no name defined] CATH domains Pfam domains --------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------- Transcript 2zcz B 5 TNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESE 73 14 24 34 44 54 64 Chain C from PDB Type:PROTEIN Length:66 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:66 14 24 34 44 54 64 MTRB_GEOSE 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIES 70 SCOP domains d2zczc_ C: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2zczC00 C:7-72 [code=2.60.40.50, no name defined] CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 2zcz C 7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIES 72 16 26 36 46 56 66 Chain D from PDB Type:PROTEIN Length:73 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:73 74 14 24 34 44 54 64 74 MTRB_GEOSE 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK--- - SCOP domains d2zczd_ D: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2zczD00 D:7-79 [code=2.60.40.50, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 2zcz D 7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAA 79 16 26 36 46 56 66 76 Chain E from PDB Type:PROTEIN Length:68 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:68 14 24 34 44 54 64 MTRB_GEOSE 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG 72 SCOP domains d2zcze_ E: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2zczE00 E:7-74 [code=2.60.40.50, no name defined] CATH domains Pfam domains -------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 2zcz E 7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG 74 16 26 36 46 56 66 Chain F from PDB Type:PROTEIN Length:66 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:66 14 24 34 44 54 64 MTRB_GEOSE 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIES 70 SCOP domains d2zczf_ F: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2zczF00 F:7-72 [code=2.60.40.50, no name defined] CATH domains Pfam domains (1) TrpBP-2zczF01 F:7-72 Pfam domains (1) Pfam domains (2) TrpBP-2zczF02 F:7-72 Pfam domains (2) Pfam domains (3) TrpBP-2zczF03 F:7-72 Pfam domains (3) Pfam domains (4) TrpBP-2zczF04 F:7-72 Pfam domains (4) Pfam domains (5) TrpBP-2zczF05 F:7-72 Pfam domains (5) Pfam domains (6) TrpBP-2zczF06 F:7-72 Pfam domains (6) SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 2zcz F 7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIES 72 16 26 36 46 56 66
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F (MTRB_GEOSE | Q9X6J6)
|
|
|
|
|
|
|