|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 3)
|
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 2EXT) |
(no "Cis Peptide Bond" information available for 2EXT) |
(no "SAP(SNP)/Variant" information available for 2EXT) |
(no "PROSITE Motif" information available for 2EXT) |
(no "Exon" information available for 2EXT) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:63 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:63 14 24 34 44 54 64 MTRB_GEOSE 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGV 67 SCOP domains d2exta_ A: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2extA00 A:7-69 [code=2.60.40.50, no name defined] CATH domains Pfam domains --------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------- Transcript 2ext A 7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGV 69 16 26 36 46 56 66 Chain B from PDB Type:PROTEIN Length:66 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:66 14 24 34 44 54 64 MTRB_GEOSE 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIES 70 SCOP domains d2extb_ B: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2extB00 B:7-72 [code=2.60.40.50, no name defined] CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 2ext B 7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIES 72 16 26 36 46 56 66 Chain C from PDB Type:PROTEIN Length:66 aligned with MTRB_GEOSE | Q9X6J6 from UniProtKB/Swiss-Prot Length:74 Alignment length:66 14 24 34 44 54 64 MTRB_GEOSE 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIES 70 SCOP domains d2extc_ C: Trp RNA-binding attenuation protein (TRAP) SCOP domains CATH domains 2extC00 C:7-72 [code=2.60.40.50, no name defined] CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 2ext C 7 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIES 72 16 26 36 46 56 66
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 2EXT) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C (MTRB_GEOSE | Q9X6J6)
|
|
|
|
|
|
|