2Q9Q - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   THE CRYSTAL STRUCTURE OF FULL LENGTH HUMAN GINS COMPLEX

Authors :   Y. P. Chang, G. Wang, X. S. Chen

Date :   13 Jun 07 (Deposition) - 07 Aug 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.36

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: E,F,G,H  (1x)

Keywords :   Elongated Spindle, Helix Bundle, Replication (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. P. Chang, G. Wang, V. Bermudez, J. Hurwitz, X. S. Chen
Crystal Structure Of The Gins Complex And Functional Insights Into Its Role In Dna Replication.
Proc. Natl. Acad. Sci. Usa V. 104 12685 2007
PubMed-ID: 17652513 | Reference-DOI: 10.1073/PNAS.0705558104

Molecule 1 - DNA REPLICATION COMPLEX GINS PROTEIN PSF2
	Chains	:	A, E
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX6P-1
	Expression System Strain	:	XA90
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	GINS2, PSF2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - GINS COMPLEX SUBUNIT 4
	Chains	:	B, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX6P-1
	Expression System Strain	:	XA90
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	GINS4
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 3 - DNA REPLICATION COMPLEX GINS PROTEIN PSF1
	Chains	:	C, G
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX6P-1
	Expression System Strain	:	XA90
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	GINS1, KIAA0186, PSF1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 4 - GINS COMPLEX SUBUNIT 3
	Chains	:	D, H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX6P-1
	Expression System Strain	:	XA90
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	GINS3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PSF3 HOMOLOG

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:					E	F	G	H

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2Q9Q)

(no "Site" information available for 2Q9Q)

(no "SS Bond" information available for 2Q9Q)

Asymmetric Unit

No.	Residues
1	Gly A:34	-	Pro A:35
2	Gly D:113	-	Pro D:114
3	Gly E:34	-	Pro E:35
4	Gly H:113	-	Pro H:114

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_051606	V	97	I	PSF1_HUMAN	Polymorphism	6076347	C/G	I	97	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_051606	V	97	I	PSF1_HUMAN	Polymorphism	6076347	C	I	97	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_051606	V	97	I	PSF1_HUMAN	Polymorphism	6076347	G	I	97	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2Q9Q)

Asymmetric Unit (20, 40)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000253462	1	ENSE00001303150	chr16:85722605-85722415	191	PSF2_HUMAN	1-30	30	2	A:1-30 E:1-30	30 30
1.2	ENST00000253462	2	ENSE00000945757	chr16:85721180-85721066	115	PSF2_HUMAN	31-69	39	2	A:31-69 E:31-69	39 39
1.3	ENST00000253462	3	ENSE00000945758	chr16:85715287-85715188	100	PSF2_HUMAN	69-102	34	2	A:69-102 E:69-102	34 34
1.4	ENST00000253462	4	ENSE00000897887	chr16:85712272-85712146	127	PSF2_HUMAN	102-144	43	2	A:102-144 E:102-144	43 43
1.5	ENST00000253462	5	ENSE00001305255	chr16:85711943-85709804	2140	PSF2_HUMAN	145-185	41	2	A:145-175 E:145-175	31 31

2.1b	ENST00000262460	1b	ENSE00001825970	chr20:25388363-25388531	169	PSF1_HUMAN	1-25	25	2	C:1-25 G:1-25	25 25
2.3b	ENST00000262460	3b	ENSE00000661036	chr20:25394426-25394490	65	PSF1_HUMAN	26-47	22	2	C:26-47 G:26-47	22 22
2.4a	ENST00000262460	4a	ENSE00000661037	chr20:25397740-25397838	99	PSF1_HUMAN	47-80	34	2	C:47-80 G:47-80	34 34
2.5	ENST00000262460	5	ENSE00000661038	chr20:25398741-25398831	91	PSF1_HUMAN	80-110	31	2	C:80-110 G:80-110	31 31
2.7	ENST00000262460	7	ENSE00001597298	chr20:25405847-25405963	117	PSF1_HUMAN	111-149	39	2	C:111-145 G:111-145	35 35
2.8	ENST00000262460	8	ENSE00001798595	chr20:25422338-25422412	75	PSF1_HUMAN	150-174	25	0	-	-
2.10b	ENST00000262460	10b	ENSE00001660487	chr20:25426559-25429191	2633	PSF1_HUMAN	175-196	22	0	-	-

3.1a	ENST00000276533	1a	ENSE00001746541	chr8:41386725-41386915	191	SLD5_HUMAN	-	0	0	-	-
3.1h	ENST00000276533	1h	ENSE00002164027	chr8:41387703-41387817	115	SLD5_HUMAN	1-32	32	2	B:21-32 F:21-32	12 12
3.2b	ENST00000276533	2b	ENSE00001790337	chr8:41393879-41393965	87	SLD5_HUMAN	33-61	29	2	B:33-61 F:33-61	29 29
3.3a	ENST00000276533	3a	ENSE00001683597	chr8:41394699-41394812	114	SLD5_HUMAN	62-99	38	2	B:62-99 (gaps) F:62-99 (gaps)	38 38
3.4	ENST00000276533	4	ENSE00001128877	chr8:41397197-41397294	98	SLD5_HUMAN	100-132	33	2	B:100-132 F:100-132	33 33
3.5	ENST00000276533	5	ENSE00000980549	chr8:41397435-41397523	89	SLD5_HUMAN	132-162	31	2	B:132-162 F:132-162	31 31
3.6b	ENST00000276533	6b	ENSE00000980550	chr8:41399328-41399418	91	SLD5_HUMAN	162-192	31	2	B:162-192 F:162-192	31 31
3.6h	ENST00000276533	6h	ENSE00001253142	chr8:41399510-41402565	3056	SLD5_HUMAN	192-223	32	2	B:192-222 F:192-222	31 31

4.1b	ENST00000318129	1b	ENSE00001827766	chr16:58426325-58426691	367	PSF3_HUMAN	1-62	62	2	D:2-62 (gaps) H:2-62 (gaps)	61 61
4.3	ENST00000318129	3	ENSE00001218868	chr16:58437002-58437235	234	PSF3_HUMAN	63-140	78	2	D:63-140 H:63-140	78 78
4.4b	ENST00000318129	4b	ENSE00001829311	chr16:58438403-58440048	1646	PSF3_HUMAN	141-216	76	2	D:141-193 H:141-193	53 53

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:175
 aligned with PSF2_HUMAN | Q9Y248 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:175
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           PSF2_HUMAN     1 MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQ 175
               SCOP domains d2q9qa2 A:1-61 automated matches                             d2q9qa1 A:62-175 DNA replication complex GINS protein PSF2                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh..eeeeee......eee..eee........eeeehhhhhhhhhh..eee......hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee....hhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:1-30         Exon 1.2  PDB: A:31-69 UniProt: 31-69  --------------------------------Exon 1.4  PDB: A:102-144 UniProt: 102-144  Exon 1.5  PDB: A:145-175        Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------Exon 1.3  PDB: A:69-102           ------------------------------------------------------------------------- Transcript 1 (2)
                 2q9q A   1 MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQ 175
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain B from PDB  Type:PROTEIN  Length:196
 aligned with SLD5_HUMAN | Q9BRT9 from UniProtKB/Swiss-Prot  Length:223

    Alignment length:202
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220  
           SLD5_HUMAN    21 LTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQL 222
               SCOP domains d2q9qb1 B:21-165 GINS complex subunit 4, SLD5                                                                                                    d2q9qb2 B:166-222 GINS complex subunit 4, SLD5            SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh.......eeeeee...eeeeee....hhhhheeeee....eeeeehhhhhhhhhh..ee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 3 (1) Exon 3.1h   Exon 3.2b  PDB: B:33-61      Exon 3.3a  PDB: B:62-99 (gaps)        Exon 3.4  PDB: B:100-132         -----------------------------Exon 3.6b  PDB: B:162-192      ------------------------------ Transcript 3 (1)
           Transcript 3 (2) ---------------------------------------------------------------------------------------------------------------Exon 3.5  PDB: B:132-162       -----------------------------Exon 3.6h  PDB: B:192-222       Transcript 3 (2)
                 2q9q B  21 LTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENL------DLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQL 222
                                    30        40        50        60    |    - |      80        90       100       110       120       130       140       150       160       170       180       190       200       210       220  
                                                                       65     72

Chain C from PDB  Type:PROTEIN  Length:145
 aligned with PSF1_HUMAN | Q14691 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:145
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140     
           PSF1_HUMAN     1 MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS 145
               SCOP domains d2q9qc_ C: automated matches                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------I------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1b  PDB: C:1-25   Exon 2.3b  PDB: C:26-4--------------------------------Exon 2.5  PDB: C:80-110        Exon 2.7  PDB: C:111-145            Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------Exon 2.4a  PDB: C:47-80           ----------------------------------------------------------------- Transcript 2 (2)
                 2q9q C   1 MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS 145
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Chain D from PDB  Type:PROTEIN  Length:186
 aligned with PSF3_HUMAN | Q9BRX5 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:192
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  
           PSF3_HUMAN     2 SEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ 193
               SCOP domains d2q9qd2 D:2-87 GINS complex subunit 3, PSF3                                           d2q9qd1 D:88-193 GINS complex subunit 3, PSF3                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...................hhhhhhhh..eeeeee...........------hhhhh......eeeeehhhhhhhh......eee..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh..hhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 4 Exon 4.1b  PDB: D:2-62 (gaps) UniProt: 1-62 [INCOMPLETE]     Exon 4.3  PDB: D:63-140 UniProt: 63-140                                       Exon 4.4b  PDB: D:141-193 UniProt: 141-216            Transcript 4
                 2q9q D   2 SEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFF------AETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ 193
                                    11        21        31        41     |   -  |     61        71        81        91       101       111       121       131       141       151       161       171       181       191  
                                                                        47     54

Chain E from PDB  Type:PROTEIN  Length:175
 aligned with PSF2_HUMAN | Q9Y248 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:175
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     
           PSF2_HUMAN     1 MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQ 175
               SCOP domains d2q9qe2 E:1-61 automated matches                             d2q9qe1 E:62-175 DNA replication complex GINS protein PSF2                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------------------Sld5-2q9qE01 E:42-153                                                                                           ---------------------- Pfam domains (1)
           Pfam domains (2) -----------------------------------------Sld5-2q9qE02 E:42-153                                                                                           ---------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhh..eeeeee......eee..eee........eeeehhhhhhhhhh..eee......hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee....hhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: E:1-30         Exon 1.2  PDB: E:31-69 UniProt: 31-69  --------------------------------Exon 1.4  PDB: E:102-144 UniProt: 102-144  Exon 1.5  PDB: E:145-175        Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------Exon 1.3  PDB: E:69-102           ------------------------------------------------------------------------- Transcript 1 (2)
                 2q9q E   1 MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQ 175
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170

Chain F from PDB  Type:PROTEIN  Length:196
 aligned with SLD5_HUMAN | Q9BRT9 from UniProtKB/Swiss-Prot  Length:223

    Alignment length:202
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220  
           SLD5_HUMAN    21 LTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQL 222
               SCOP domains d2q9qf1 F:21-165 GINS complex subunit 4, SLD5                                                                                                    d2q9qf2 F:166-222 GINS complex subunit 4, SLD5            SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -Sld5-2q9qF01 F:22-127                                                                                     ----------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -Sld5-2q9qF02 F:22-127                                                                                     ----------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh.......eeeeee...eeeeee....hhhhheeeee....eeeee...hhhhhhh..ee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 3 (1) Exon 3.1h   Exon 3.2b  PDB: F:33-61      Exon 3.3a  PDB: F:62-99 (gaps)        Exon 3.4  PDB: F:100-132         -----------------------------Exon 3.6b  PDB: F:162-192      ------------------------------ Transcript 3 (1)
           Transcript 3 (2) ---------------------------------------------------------------------------------------------------------------Exon 3.5  PDB: F:132-162       -----------------------------Exon 3.6h  PDB: F:192-222       Transcript 3 (2)
                 2q9q F  21 LTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENL------DLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQL 222
                                    30        40        50        60    |    - |      80        90       100       110       120       130       140       150       160       170       180       190       200       210       220  
                                                                       65     72

Chain G from PDB  Type:PROTEIN  Length:145
 aligned with PSF1_HUMAN | Q14691 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:145
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140     
           PSF1_HUMAN     1 MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS 145
               SCOP domains d2q9qg_ G: automated matches                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh..hhhhhhhhhhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------I------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1b  PDB: G:1-25   Exon 2.3b  PDB: G:26-4--------------------------------Exon 2.5  PDB: G:80-110        Exon 2.7  PDB: G:111-145            Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------Exon 2.4a  PDB: G:47-80           ----------------------------------------------------------------- Transcript 2 (2)
                 2q9q G   1 MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS 145
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Chain H from PDB  Type:PROTEIN  Length:186
 aligned with PSF3_HUMAN | Q9BRX5 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:192
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  
           PSF3_HUMAN     2 SEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ 193
               SCOP domains d2q9qh2 H:2-87 GINS complex subunit 3, PSF3                                           d2q9qh1 H:88-193 GINS complex subunit 3, PSF3                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) ----------------------------------------------------------------Sld5-2q9qH01 H:66-173                                                                                       -------------------- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------Sld5-2q9qH02 H:66-173                                                                                       -------------------- Pfam domains (2)
         Sec.struct. author ...................hhhhhhhh..eeeeee...hhhhh...------hhhhhh.....eeeeehhhhhhhh......eee..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 4 Exon 4.1b  PDB: H:2-62 (gaps) UniProt: 1-62 [INCOMPLETE]     Exon 4.3  PDB: H:63-140 UniProt: 63-140                                       Exon 4.4b  PDB: H:141-193 UniProt: 141-216            Transcript 4
                 2q9q H   2 SEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFF------AETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ 193
                                    11        21        31        41     |   -  |     61        71        81        91       101       111       121       131       141       151       161       171       181       191  
                                                                        47     54

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 2Q9Q)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Sld5] (1)

Family: Sld5 (1)

Homo sapiens (Human) (1)

1a	Sld5-2q9qE01	E:42-153
1b	Sld5-2q9qE02	E:42-153
1c	Sld5-2q9qH01	H:66-173
1d	Sld5-2q9qH02	H:66-173
1e	Sld5-2q9qF01	F:22-127
1f	Sld5-2q9qF02	F:22-127

Asymmetric Unit(hide GO term definitions)

Chain A,E (PSF2_HUMAN | Q9Y248)

molecular function
	GO:0043138	3'-5' DNA helicase activity	Catalysis of the unwinding of the DNA helix in the direction 3' to 5'.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0032508	DNA duplex unwinding	The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006271	DNA strand elongation involved in DNA replication	The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
	GO:0000727	double-strand break repair via break-induced replication	The error-free repair of a double-strand break in DNA in which the centromere-proximal end of a broken chromosome searches for a homologous region in an intact chromosome. DNA synthesis initiates from the 3' end of the invading DNA strand, using the intact chromosome as the template, and progresses to the end of the chromosome.
	GO:1902975	mitotic DNA replication initiation	Any DNA replication initiation involved in mitotic cell cycle DNA replication.
cellular component
	GO:0000811	GINS complex	A heterotetrameric protein complex that associates with replication origins, where it is required for the initiation of DNA replication, and with replication forks.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0031298	replication fork protection complex	A protein complex conserved in eukaryotes and associated with the replication fork; the complex stabilizes stalled replication forks and is thought to be involved in coordinating leading- and lagging-strand synthesis and in replication checkpoint signaling.

Chain B,F (SLD5_HUMAN | Q9BRT9)

molecular function
	GO:0043138	3'-5' DNA helicase activity	Catalysis of the unwinding of the DNA helix in the direction 3' to 5'.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0032508	DNA duplex unwinding	The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006270	DNA replication initiation	The process in which DNA-dependent DNA replication is started; this involves the separation of a stretch of the DNA double helix, the recruitment of DNA polymerases and the initiation of polymerase action.
	GO:0006271	DNA strand elongation involved in DNA replication	The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
	GO:0000727	double-strand break repair via break-induced replication	The error-free repair of a double-strand break in DNA in which the centromere-proximal end of a broken chromosome searches for a homologous region in an intact chromosome. DNA synthesis initiates from the 3' end of the invading DNA strand, using the intact chromosome as the template, and progresses to the end of the chromosome.
	GO:0001833	inner cell mass cell proliferation	The proliferation of cells in the inner cell mass.
cellular component
	GO:0000811	GINS complex	A heterotetrameric protein complex that associates with replication origins, where it is required for the initiation of DNA replication, and with replication forks.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0031298	replication fork protection complex	A protein complex conserved in eukaryotes and associated with the replication fork; the complex stabilizes stalled replication forks and is thought to be involved in coordinating leading- and lagging-strand synthesis and in replication checkpoint signaling.

Chain C,G (PSF1_HUMAN | Q14691)

molecular function
	GO:0043138	3'-5' DNA helicase activity	Catalysis of the unwinding of the DNA helix in the direction 3' to 5'.
biological process
	GO:0032508	DNA duplex unwinding	The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006271	DNA strand elongation involved in DNA replication	The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
	GO:1902983	DNA strand elongation involved in mitotic DNA replication	Any DNA strand elongation involved in mitotic cell cycle DNA replication.
	GO:0001833	inner cell mass cell proliferation	The proliferation of cells in the inner cell mass.
cellular component
	GO:0000811	GINS complex	A heterotetrameric protein complex that associates with replication origins, where it is required for the initiation of DNA replication, and with replication forks.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain D,H (PSF3_HUMAN | Q9BRX5)

biological process
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006271	DNA strand elongation involved in DNA replication	The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2q9q)

	Sites
(no "Sites" information available for 2q9q)

	Cis Peptide Bonds
		Gly A:34 - Pro A:35	[ RasMol ]
		Gly D:113 - Pro D:114	[ RasMol ]
		Gly E:34 - Pro E:35	[ RasMol ]
		Gly H:113 - Pro H:114	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2q9q
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PSF1_HUMAN \| Q14691
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PSF2_HUMAN \| Q9Y248
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PSF3_HUMAN \| Q9BRX5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SLD5_HUMAN \| Q9BRT9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PSF1_HUMAN \| Q14691
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PSF2_HUMAN \| Q9Y248
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PSF3_HUMAN \| Q9BRX5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SLD5_HUMAN \| Q9BRT9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PSF1_HUMAN \| Q14691	:	2e9x 2eho
	PSF2_HUMAN \| Q9Y248	:	2e9x 2eho
	PSF3_HUMAN \| Q9BRX5	:	2e9x 2eho
	SLD5_HUMAN \| Q9BRT9	:	2e9x 2eho

(no "Related Entries Specified in the PDB File" available for 2Q9Q)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (0, 0)

Exons (20, 40)

Sequences/Alignments

Classification and Annotation

SCOP Domains (7, 14)

CATH Domains (0, 0)

Pfam Domains (1, 6)

Gene Ontology (15, 38)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File