2EHO - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:161
 aligned with SLD5_HUMAN | Q9BRT9 from UniProtKB/Swiss-Prot  Length:223

    Alignment length:192
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210  
           SLD5_HUMAN    21 LTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIA 212
               SCOP domains d2ehoa1 A:21-165 GINS complex subunit 4, SLD5                                                                                                    ---------                           ----------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh----hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhh............---------------------------.....hhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 3 (1) Exon 3.1h   Exon 3.2b  PDB: A:33-61      Exon 3.3a  PDB: A:62-99 (gaps)        Exon 3.4  PDB: A:100-132         -----------------------------Exon 3.6b  PDB: A:162-174      -------------------- Transcript 3 (1)
           Transcript 3 (2) ---------------------------------------------------------------------------------------------------------------Exon 3.5  PDB: A:132-162       -----------------------------Exon 3.6h             Transcript 3 (2)
                 2eho A  21 LTPAELIERLEQAWmNEKFAPELLESKPEIVECVmEQLEHmEENLR----EDLKVSIHQmEmERIRYVLSSYLRCRLmKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFmANTESYLKNVALKHmPPNLQKVDLFRAVPKPDLDSYVFLR---------------------------SQHLIRYKTIA 212
                                    30    |   40        50    |   60|    |   -|       80 |      90       100       110       120       130   |   140       150       160       170   |     -         -         - |     210  
                                         35-MSE              55-MSE |   66   71       80-MSE            98-MSE                             134-MSE        149-MSE                  174                         202          
                                                                   61-MSE               82-MSE

Chain B from PDB  Type:PROTEIN  Length:145
 aligned with PSF1_HUMAN | Q14691 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:145
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140     
           PSF1_HUMAN     1 MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS 145
               SCOP domains d2ehob1 B:1-145 DNA replication complex GINS protein PSF1                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------I------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1b  PDB: B:1-25   Exon 2.3b  PDB: B:26-4--------------------------------Exon 2.5  PDB: B:80-110        Exon 2.7  PDB: B:111-145            Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------Exon 2.4a  PDB: B:47-80           ----------------------------------------------------------------- Transcript 2 (2)
                 2eho B   1 mFCEKAmELIRELHRAPEGQLPAFNEDGLRQVLEEmKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHmAAEEmEWFNNYKRSLATYmRSLGGDEGLDITQDmKPPKS 145
                            |     | 10        20        30     |  40        50        60        70        80        90       100     | 110|      120    |  130       140     
                            |     7-MSE                       36-MSE                                                               106-MSE|           125-MSE        140-MSE 
                            1-MSE                                                                                                       111-MSE

Chain C from PDB  Type:PROTEIN  Length:168
 aligned with PSF2_HUMAN | Q9Y248 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:174
                             1                                                                                                                                                                            
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169    
           PSF2_HUMAN     - -MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTN 173
               SCOP domains -d2ehoc2 C:1-61 DNA replication complex GINS protein PSF2     d2ehoc1 C:62-173 DNA replication complex GINS protein PSF2                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhh..eeeeee......eee..eee........eeeehhhhhhhhhh..eeee.....hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.------..........hhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) -Exon 1.1  PDB: C:1-30         Exon 1.2  PDB: C:31-69 UniProt: 31-69  --------------------------------Exon 1.4  PDB: C:102-139 UniProt: 102-144  Exon 1.5  PDB: C:146-173      Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.3  PDB: C:69-102           ----------------------------------------------------------------------- Transcript 1 (2)
                 2eho C   0 mmDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWmDVEKLEKmRDHERKEETFTPmPSPYYmELTKLLLNHASDNIPKADEIRTLVKDmWDTRIAKLRVSADSFVRQQ------DNLTLmEINTSGTFLTQALNHmYKLRTN 173
                            ||       9        19        29        39        49        59      | 69    |   79       |89   |    99       109       119|      129       139      |149 |     159       169    
                            0-MSE                                                            66-MSE  74-MSE       87-MSE |                        120-MSE            139    146    |             167-MSE  
                             1-MSE                                                                                      93-MSE                                                   151-MSE

Chain D from PDB  Type:PROTEIN  Length:182
 aligned with PSF3_HUMAN | Q9BRX5 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:190
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192
           PSF3_HUMAN     3 EAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKG 192
               SCOP domains d2ehod2 D:3-87 GINS complex subunit 3, PSF3                                          d2ehod1 D:88-192 GINS complex subunit 3, PSF3                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhh....eeee...ee........--------.ee....eee.hhhhhhhhh......eee........hhhhhhhhhhhhh.......hhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 4 Exon 4.1b  PDB: D:3-62 (gaps) UniProt: 1-62 [INCOMPLETE]    Exon 4.3  PDB: D:63-140 UniProt: 63-140                                       Exon 4.4b  PDB: D:141-192 UniProt: 141-216           Transcript 4
                 2eho D   3 EAYFRVESGALGPEENFLSLDDILmSHEKLPVRTETAmPRLGAFFLE--------NAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKmGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRImDSSQNAYNEDTSALVARLDEmERGLFQTGQKGLNDFQCWEKG 192
                                    12        22    |   32       |42      |  -     |  62        72        82        92       102       112       122       132       142       152       162       172       182       192
                                                   27-MSE       40-MSE   49       58                                                   112-MSE                               150-MSE              171-MSE

Chain E from PDB  Type:PROTEIN  Length:190
 aligned with SLD5_HUMAN | Q9BRT9 from UniProtKB/Swiss-Prot  Length:223

    Alignment length:194
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209    
           SLD5_HUMAN    20 VLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAP 213
               SCOP domains d2ehoe1 E:20-165 automated matches                                                                                                                d2ehoe2 E:166-213 automated matches              SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..----.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh.......eeeee....eeeeee.........eeeee....eeeeehhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 3 (1) Exon 3.1h    Exon 3.2b  PDB: E:33-61      Exon 3.3a  PDB: E:62-99 (gaps)        Exon 3.4  PDB: E:100-132         -----------------------------Exon 3.6b  PDB: E:162-192      --------------------- Transcript 3 (1)
           Transcript 3 (2) ----------------------------------------------------------------------------------------------------------------Exon 3.5  PDB: E:132-162       -----------------------------Exon 3.6h [INCOMPLETE] Transcript 3 (2)
                 2eho E  20 VLTPAELIERLEQAWmNEKFAPELLESKPEIVECVmEQLEHmEENLR----EDLKVSIHQmEmERIRYVLSSYLRCRLmKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFmANTESYLKNVALKHmPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAP 213
                                    29     |  39        49     |  59 |    |  - |      79| |     89        99       109       119       129    |  139       149       159       169       179       189       199       209    
                                          35-MSE              55-MSE |   66   71       80-MSE            98-MSE                             134-MSE        149-MSE                                                            
                                                                    61-MSE               82-MSE

Chain F from PDB  Type:PROTEIN  Length:146
 aligned with PSF1_HUMAN | Q14691 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:146
                             1                                                                                                                                                
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139      
           PSF1_HUMAN     - -MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS 145
               SCOP domains d2ehof_ F: DNA replication complex GINS protein PSF1                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhh.hhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------I------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) -Exon 2.1b  PDB: F:1-25   Exon 2.3b  PDB: F:26-4--------------------------------Exon 2.5  PDB: F:80-110        Exon 2.7  PDB: F:111-145            Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------------Exon 2.4a  PDB: F:47-80           ----------------------------------------------------------------- Transcript 2 (2)
                 2eho F   0 mmFCEKAmELIRELHRAPEGQLPAFNEDGLRQVLEEmKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHmAAEEmEWFNNYKRSLATYmRSLGGDEGLDITQDmKPPKS 145
                            ||     | 9        19        29      | 39        49        59        69        79        89        99      |109 |     119     | 129       139|     
                            0-MSE  7-MSE                       36-MSE                                                               106-MSE|           125-MSE        140-MSE 
                             1-MSE                                                                                                       111-MSE

Chain G from PDB  Type:PROTEIN  Length:176
 aligned with PSF2_HUMAN | Q9Y248 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:176
                             1                                                                                                                                                                              
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169      
           PSF2_HUMAN     - -MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQ 175
               SCOP domains d2ehog2 G:0-61 automated matches                              d2ehog1 G:62-175 DNA replication complex GINS protein PSF2                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh..eeee........ee....ee........eeeehhhhhhhhh............hhhhhhhhhhhhhhhh........hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee....hhhhhh.hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -Exon 1.1  PDB: G:1-30         Exon 1.2  PDB: G:31-69 UniProt: 31-69  --------------------------------Exon 1.4  PDB: G:102-144 UniProt: 102-144  Exon 1.5  PDB: G:145-175        Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.3  PDB: G:69-102           ------------------------------------------------------------------------- Transcript 1 (2)
                 2eho G   0 mmDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWmDVEKLEKmRDHERKEETFTPmPSPYYmELTKLLLNHASDNIPKADEIRTLVKDmWDTRIAKLRVSADSFVRQQEAHAKLDNLTLmEINTSGTFLTQALNHmYKLRTNLQ 175
                            ||       9        19        29        39        49        59      | 69    |   79       |89   |    99       109       119|      129       139       149 |     159       169      
                            0-MSE                                                            66-MSE  74-MSE       87-MSE |                        120-MSE                        151-MSE         167-MSE    
                             1-MSE                                                                                      93-MSE

Chain H from PDB  Type:PROTEIN  Length:183
 aligned with PSF3_HUMAN | Q9BRX5 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:191
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192 
           PSF3_HUMAN     3 EAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ 193
               SCOP domains d2ehoh2 H:3-87 GINS complex subunit 3, PSF3                                          d2ehoh1 H:88-193 GINS complex subunit 3, PSF3                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhh..eeeeee......hhhhh.--------........eeeeehhhhhhhh......eee..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 4 Exon 4.1b  PDB: H:3-62 (gaps) UniProt: 1-62 [INCOMPLETE]    Exon 4.3  PDB: H:63-140 UniProt: 63-140                                       Exon 4.4b  PDB: H:141-193 UniProt: 141-216            Transcript 4
                 2eho H   3 EAYFRVESGALGPEENFLSLDDILmSHEKLPVRTETAmPRLGAFFL--------DNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKmGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRImDSSQNAYNEDTSALVARLDEmERGLFQTGQKGLNDFQCWEKGQ 193
                                    12        22    |   32       |42     |   -    |   62        72        82        92       102       112       122       132       142       152       162       172       182       192 
                                                   27-MSE       40-MSE  48       57                                                    112-MSE                               150-MSE              171-MSE

Chain I from PDB  Type:PROTEIN  Length:192
 aligned with SLD5_HUMAN | Q9BRT9 from UniProtKB/Swiss-Prot  Length:223

    Alignment length:192
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210  
           SLD5_HUMAN    21 LTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIA 212
               SCOP domains d2ehoi1 I:21-165 automated matches                                                                                                               d2ehoi2 I:166-212 automated matches             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh.......eeeee.....eeeee.........eeeee....eeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 3 (1) Exon 3.1h   Exon 3.2b  PDB: I:33-61      Exon 3.3a  PDB: I:62-99 UniProt: 62-99Exon 3.4  PDB: I:100-132         -----------------------------Exon 3.6b  PDB: I:162-192      -------------------- Transcript 3 (1)
           Transcript 3 (2) ---------------------------------------------------------------------------------------------------------------Exon 3.5  PDB: I:132-162       -----------------------------Exon 3.6h             Transcript 3 (2)
                 2eho I  21 LTPAELIERLEQAWmNEKFAPELLESKPEIVECVmEQLEHmEENLRRAKREDLKVSIHQmEmERIRYVLSSYLRCRLmKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFmANTESYLKNVALKHmPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIA 212
                                    30    |   40        50    |   60|       70        80 |      90       100       110       120       130   |   140       150       160       170       180       190       200       210  
                                         35-MSE              55-MSE |                 80-MSE            98-MSE                             134-MSE        149-MSE                                                           
                                                                   61-MSE               82-MSE

Chain J from PDB  Type:PROTEIN  Length:145
 aligned with PSF1_HUMAN | Q14691 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:145
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140     
           PSF1_HUMAN     1 MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKS 145
               SCOP domains d2ehoj_ J: DNA replication complex GINS protein PSF1                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------I------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1b  PDB: J:1-25   Exon 2.3b  PDB: J:26-4--------------------------------Exon 2.5  PDB: J:80-110        Exon 2.7  PDB: J:111-145            Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------Exon 2.4a  PDB: J:47-80           ----------------------------------------------------------------- Transcript 2 (2)
                 2eho J   1 mFCEKAmELIRELHRAPEGQLPAFNEDGLRQVLEEmKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHmAAEEmEWFNNYKRSLATYmRSLGGDEGLDITQDmKPPKS 145
                            |     | 10        20        30     |  40        50        60        70        80        90       100     | 110|      120    |  130       140     
                            1-MSE 7-MSE                       36-MSE                                                               106-MSE|           125-MSE        140-MSE 
                                                                                                                                        111-MSE

Chain K from PDB  Type:PROTEIN  Length:175
 aligned with PSF2_HUMAN | Q9Y248 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:175
                             1                                                                                                                                                                             
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169     
           PSF2_HUMAN     - -MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNL 174
               SCOP domains d2ehok2 K:0-61 automated matches                              d2ehok1 K:62-174 DNA replication complex GINS protein PSF2                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh..eeeeee......eee..eee........eeeehhhhhhhhhh..eeee.....hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee....hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -Exon 1.1  PDB: K:1-30         Exon 1.2  PDB: K:31-69 UniProt: 31-69  --------------------------------Exon 1.4  PDB: K:102-144 UniProt: 102-144  Exon 1.5  PDB: K:145-174       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.3  PDB: K:69-102           ------------------------------------------------------------------------ Transcript 1 (2)
                 2eho K   0 mmDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWmDVEKLEKmRDHERKEETFTPmPSPYYmELTKLLLNHASDNIPKADEIRTLVKDmWDTRIAKLRVSADSFVRQQEAHAKLDNLTLmEINTSGTFLTQALNHmYKLRTNL 174
                            ||       9        19        29        39        49        59      | 69    |   79       |89   |    99       109       119|      129       139       149 |     159       169     
                            0-MSE                                                            66-MSE  74-MSE       87-MSE |                        120-MSE                        151-MSE         167-MSE   
                             1-MSE                                                                                      93-MSE

Chain L from PDB  Type:PROTEIN  Length:182
 aligned with PSF3_HUMAN | Q9BRX5 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:191
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192 
           PSF3_HUMAN     3 EAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQ 193
               SCOP domains d2ehol2 L:3-87 GINS complex subunit 3, PSF3                                          d2ehol1 L:88-193 GINS complex subunit 3, PSF3                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhh.eeeeee...ee.hhhhh.---------.ee....eeeeehhhhhhhh......eee..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 4 Exon 4.1b  PDB: L:3-62 (gaps) UniProt: 1-62 [INCOMPLETE]    Exon 4.3  PDB: L:63-140 UniProt: 63-140                                       Exon 4.4b  PDB: L:141-193 UniProt: 141-216            Transcript 4
                 2eho L   3 EAYFRVESGALGPEENFLSLDDILmSHEKLPVRTETAmPRLGAFFL---------NAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKmGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRImDSSQNAYNEDTSALVARLDEmERGLFQTGQKGLNDFQCWEKGQ 193
                                    12        22    |   32       |42     |   -     |  62        72        82        92       102       112       122       132       142       152       162       172       182       192 
                                                   27-MSE       40-MSE  48        58                                                   112-MSE                               150-MSE              171-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,E,I (SLD5_HUMAN | Q9BRT9)

molecular function
	GO:0043138	3'-5' DNA helicase activity	Catalysis of the unwinding of the DNA helix in the direction 3' to 5'.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0032508	DNA duplex unwinding	The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006270	DNA replication initiation	The process in which DNA-dependent DNA replication is started; this involves the separation of a stretch of the DNA double helix, the recruitment of DNA polymerases and the initiation of polymerase action.
	GO:0006271	DNA strand elongation involved in DNA replication	The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
	GO:0000727	double-strand break repair via break-induced replication	The error-free repair of a double-strand break in DNA in which the centromere-proximal end of a broken chromosome searches for a homologous region in an intact chromosome. DNA synthesis initiates from the 3' end of the invading DNA strand, using the intact chromosome as the template, and progresses to the end of the chromosome.
	GO:0001833	inner cell mass cell proliferation	The proliferation of cells in the inner cell mass.
cellular component
	GO:0000811	GINS complex	A heterotetrameric protein complex that associates with replication origins, where it is required for the initiation of DNA replication, and with replication forks.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0031298	replication fork protection complex	A protein complex conserved in eukaryotes and associated with the replication fork; the complex stabilizes stalled replication forks and is thought to be involved in coordinating leading- and lagging-strand synthesis and in replication checkpoint signaling.

Chain B,F,J (PSF1_HUMAN | Q14691)

molecular function
	GO:0043138	3'-5' DNA helicase activity	Catalysis of the unwinding of the DNA helix in the direction 3' to 5'.
biological process
	GO:0032508	DNA duplex unwinding	The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006271	DNA strand elongation involved in DNA replication	The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
	GO:1902983	DNA strand elongation involved in mitotic DNA replication	Any DNA strand elongation involved in mitotic cell cycle DNA replication.
	GO:0001833	inner cell mass cell proliferation	The proliferation of cells in the inner cell mass.
cellular component
	GO:0000811	GINS complex	A heterotetrameric protein complex that associates with replication origins, where it is required for the initiation of DNA replication, and with replication forks.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,G,K (PSF2_HUMAN | Q9Y248)

molecular function
	GO:0043138	3'-5' DNA helicase activity	Catalysis of the unwinding of the DNA helix in the direction 3' to 5'.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0032508	DNA duplex unwinding	The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006271	DNA strand elongation involved in DNA replication	The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
	GO:0000727	double-strand break repair via break-induced replication	The error-free repair of a double-strand break in DNA in which the centromere-proximal end of a broken chromosome searches for a homologous region in an intact chromosome. DNA synthesis initiates from the 3' end of the invading DNA strand, using the intact chromosome as the template, and progresses to the end of the chromosome.
	GO:1902975	mitotic DNA replication initiation	Any DNA replication initiation involved in mitotic cell cycle DNA replication.
cellular component
	GO:0000811	GINS complex	A heterotetrameric protein complex that associates with replication origins, where it is required for the initiation of DNA replication, and with replication forks.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0031298	replication fork protection complex	A protein complex conserved in eukaryotes and associated with the replication fork; the complex stabilizes stalled replication forks and is thought to be involved in coordinating leading- and lagging-strand synthesis and in replication checkpoint signaling.

Chain D,H,L (PSF3_HUMAN | Q9BRX5)

biological process
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006271	DNA strand elongation involved in DNA replication	The process in which a DNA strand is synthesized from template DNA during replication by the action of polymerases, which add nucleotides to the 3' end of the nascent DNA strand.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 105)

Sites (17, 17)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 3)

PROSITE Motifs (0, 0)

Exons (20, 60)

Sequences/Alignments

Classification and Annotation

SCOP Domains (8, 20)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (15, 38)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File