Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN FERROCHELATASE MUTANT WITH HIS 263 REPLACED BY CYS
 
Authors :  H. A. Dailey, C. -K. Wu, P. Horanyi, A. E. Medlock, A. E. W. Najahi- Missaoui, A. Burden, T. A. Dailey, J. P. Rose
Date :  25 Apr 07  (Deposition) - 02 Oct 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Ferrochelatase; H263C; Fe2S2 Cluster; Heme Biosynthesis; Protoheme; Ferro-Lyase; Mature Length; Proteolytically Processed Mitochondrial Inner Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. A. Dailey, C. -K. Wu, P. Horanyi, A. E. Medlock, W. Najahi-Missaoui, A. E. Burden, T. A. Dailey, J. P. Rose
Altered Orientation Of Active Site Residues In Variants Of Human Ferrochelatase. Evidence For A Hydrogen Bond Network Involved In Catalysis
Biochemistry V. 46 7973 2007
PubMed-ID: 17567154  |  Reference-DOI: 10.1021/BI700151F
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FERROCHELATASE, MITOCHONDRIAL
    Chains: A, B
    EC Number: 4.99.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PHDTF20
    Expression System Strain: JM109
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: MATURE PROTEIN
    Gene: FECH
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: PROTOHEME FERRO-LYASE;
HEME SYNTHETASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric/Biological Unit (2, 8)
No.NameCountTypeFull Name
1CHD6Ligand/IonCHOLIC ACID
2FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER

(-) Sites  (0, 0)

(no "Site" information available for 2PO5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PO5)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Ala A:155 -Pro A:156
2His A:167 -Pro A:168
3Gly A:312 -Pro A:313
4Ala B:155 -Pro B:156
5His B:167 -Pro B:168
6Gly B:312 -Pro B:313

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (22, 44)

Asymmetric/Biological Unit (22, 44)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_030554I71KHEMH_HUMANDisease (EPP)  ---A/BI71K
02UniProtVAR_012028R96QHEMH_HUMANPolymorphism1041951A/BR96Q
03UniProtVAR_030555Q139LHEMH_HUMANDisease (EPP)  ---A/BQ139L
04UniProtVAR_030556S151PHEMH_HUMANDisease (EPP)  ---A/BS151P
05UniProtVAR_030557E178KHEMH_HUMANDisease (EPP)  ---A/BE178K
06UniProtVAR_030558L182RHEMH_HUMANDisease (EPP)  ---A/BL182R
07UniProtVAR_002384I186THEMH_HUMANDisease (EPP)  ---A/BI186T
08UniProtVAR_030559Y191HHEMH_HUMANDisease (EPP)  ---A/BY191H
09UniProtVAR_030560P192THEMH_HUMANDisease (EPP)  ---A/BP192T
10UniProtVAR_030561C236YHEMH_HUMANDisease (EPP)761962617A/BC236Y
11UniProtVAR_030562F260LHEMH_HUMANDisease (EPP)  ---A/BF260L
12UniProtVAR_054629S264LHEMH_HUMANDisease (EPP)  ---A/BS264L
13UniProtVAR_002385M267IHEMH_HUMANDisease (EPP)118204037A/BM267I
14UniProtVAR_030563T283IHEMH_HUMANDisease (EPP)  ---A/BT283I
15UniProtVAR_030564M288KHEMH_HUMANDisease (EPP)  ---A/BM288K
16UniProtVAR_030565P334LHEMH_HUMANDisease (EPP)150146721A/BP334L
17UniProtVAR_030566V362GHEMH_HUMANDisease (EPP)118204040A/BV362G
18UniProtVAR_030567K379NHEMH_HUMANDisease (EPP)  ---A/BK379N
19UniProtVAR_002386H386PHEMH_HUMANDisease (EPP)  ---A/BH386P
20UniProtVAR_030568C406SHEMH_HUMANDisease (EPP)  ---A/BC406S
21UniProtVAR_030569C406YHEMH_HUMANDisease (EPP)  ---A/BC406Y
22UniProtVAR_002387F417SHEMH_HUMANDisease (EPP)118204039A/BF417S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FERROCHELATASEPS00534 Ferrochelatase signature.HEMH_HUMAN258-276
 
  2A:258-276
B:258-276

(-) Exons   (10, 20)

Asymmetric/Biological Unit (10, 20)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002620931aENSE00001229850chr18:55254004-55253786219HEMH_HUMAN1-23230--
1.2aENST000002620932aENSE00000669631chr18:55247431-55247305127HEMH_HUMAN23-65432A:65-65
B:65-65
1
1
1.3ENST000002620933ENSE00001229830chr18:55240597-55240478120HEMH_HUMAN65-105412A:65-105
B:65-105
41
41
1.4ENST000002620934ENSE00000669629chr18:55238772-55238624149HEMH_HUMAN105-155512A:105-155
B:105-155
51
51
1.5ENST000002620935ENSE00000669628chr18:55233813-55233679135HEMH_HUMAN155-200462A:155-200
B:155-200
46
46
1.6ENST000002620936ENSE00000669627chr18:55230212-55230106107HEMH_HUMAN200-235362A:200-235
B:200-235
36
36
1.7ENST000002620937ENSE00001229801chr18:55226475-5522637799HEMH_HUMAN236-268332A:236-268
B:236-268
33
33
1.8ENST000002620938ENSE00000669625chr18:55222184-55222077108HEMH_HUMAN269-304362A:269-304
B:269-304
36
36
1.9ENST000002620939ENSE00001229786chr18:55221656-55221492165HEMH_HUMAN305-359552A:305-359
B:305-359
55
55
1.10ENST0000026209310ENSE00000669622chr18:55218606-5521854760HEMH_HUMAN360-379202A:360-379
B:360-379
20
20
1.11bENST0000026209311bENSE00001229844chr18:55218078-552155152564HEMH_HUMAN380-423442A:380-423
B:380-423
44
44

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:359
 aligned with HEMH_HUMAN | P22830 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:359
                                    74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414         
           HEMH_HUMAN    65 RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL 423
               SCOP domains d2po5a_ A: Ferrochelatase                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 2po5A01 A:65-227,A:371-423  [code=3.40.50.1400, no name defined]                                                                                                   2po5A02 A:228-370  [code=3.40.50.1400, no name defined]                                                                                        2po5A01 A:65-227,A:371-423                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhheeeeeee..hhhhhh...hhhhhhhhhhhhhhhhh.....eeeeee...........hhhhhhhhhhhh...eeeeee......hhhhhh.......hhhhhhhh..eeee......hhhhhhhhhhhhhhhhhhh...hhhhhh.......hhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) ------K------------------------Q------------------------------------------L-----------P--------------------------K---R---T----HT-------------------------------------------Y-----------------------L---L--I---------------I----K---------------------------------------------L---------------------------G----------------N------P-------------------S----------S------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y----------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FERROCHELATASE     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1---------------------------------------Exon 1.4  PDB: A:105-155 UniProt: 105-155          --------------------------------------------Exon 1.6  PDB: A:200-235            Exon 1.7  PDB: A:236-268         Exon 1.8  PDB: A:269-304            Exon 1.9  PDB: A:305-359 UniProt: 305-359              Exon 1.10           Exon 1.11b  PDB: A:380-423 UniProt: 380-423  Transcript 1 (1)
           Transcript 1 (2) Exon 1.3  PDB: A:65-105 UniProt: 65-105  -------------------------------------------------Exon 1.5  PDB: A:155-200 UniProt: 155-200     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2po5 A  65 RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSACSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL 423
                                    74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414         

Chain B from PDB  Type:PROTEIN  Length:359
 aligned with HEMH_HUMAN | P22830 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:359
                                    74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414         
           HEMH_HUMAN    65 RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL 423
               SCOP domains d2po5b_ B: Ferrochelatase                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 2po5B01 B:65-227,B:371-423  [code=3.40.50.1400, no name defined]                                                                                                   2po5B02 B:228-370  [code=3.40.50.1400, no name defined]                                                                                        2po5B01 B:65-227,B:371-423                            CATH domains
           Pfam domains (1) ---Ferrochelatase-2po5B01 B:68-389                                                                                                                                                                                                                                                                                                   ---------------------------------- Pfam domains (1)
           Pfam domains (2) ---Ferrochelatase-2po5B02 B:68-389                                                                                                                                                                                                                                                                                                   ---------------------------------- Pfam domains (2)
         Sec.struct. author ....eeeeeee.....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhheeeeeee..hhhhhh...hhhhhhhhhhhhhhhhh.....eeeeee...........hhhhhhhhhhhh...eeeee.......hhhhhh.......hhhhhhhh..eeee......hhhhhhhhhhhhhhhhhhh...hhhhhh.......hhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) ------K------------------------Q------------------------------------------L-----------P--------------------------K---R---T----HT-------------------------------------------Y-----------------------L---L--I---------------I----K---------------------------------------------L---------------------------G----------------N------P-------------------S----------S------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y----------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FERROCHELATASE     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1---------------------------------------Exon 1.4  PDB: B:105-155 UniProt: 105-155          --------------------------------------------Exon 1.6  PDB: B:200-235            Exon 1.7  PDB: B:236-268         Exon 1.8  PDB: B:269-304            Exon 1.9  PDB: B:305-359 UniProt: 305-359              Exon 1.10           Exon 1.11b  PDB: B:380-423 UniProt: 380-423  Transcript 1 (1)
           Transcript 1 (2) Exon 1.3  PDB: B:65-105 UniProt: 65-105  -------------------------------------------------Exon 1.5  PDB: B:155-200 UniProt: 155-200     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2po5 B  65 RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSACSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL 423
                                    74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (25, 25)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (HEMH_HUMAN | P22830)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0004325    ferrochelatase activity    Catalysis of the reaction: protoheme = Fe(2+) + protoporphyrin IX.
    GO:0008198    ferrous iron binding    Interacting selectively and non-covalently with ferrous iron, Fe(II).
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0071549    cellular response to dexamethasone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a dexamethasone stimulus.
    GO:0006091    generation of precursor metabolites and energy    The chemical reactions and pathways resulting in the formation of precursor metabolites, substances from which energy is derived, and any process involved in the liberation of energy from these substances.
    GO:0006783    heme biosynthetic process    The chemical reactions and pathways resulting in the formation of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring, from less complex precursors.
    GO:0006779    porphyrin-containing compound biosynthetic process    The chemical reactions and pathways resulting in the formation of any member of a large group of derivatives or analogs of porphyrin. Porphyrin consists of a ring of four pyrrole nuclei linked each to the next at their alpha positions through a methine group.
    GO:0046501    protoporphyrinogen IX metabolic process    The chemical reactions and pathways involving protoporphyrinogen IX, the specific substrate for the enzyme ferrochelatase, which catalyzes the insertion of iron to form protoheme. It is probably also the substrate for chlorophyll formation.
    GO:0046685    response to arsenic-containing substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an arsenic stimulus from compounds containing arsenic, including arsenates, arsenites, and arsenides.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0045471    response to ethanol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
    GO:0017085    response to insecticide    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insecticide stimulus. Insecticides are chemicals used to kill insects.
    GO:0010288    response to lead ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lead ion stimulus.
    GO:0009416    response to light stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a light stimulus, electromagnetic radiation of wavelengths classified as infrared, visible or ultraviolet light.
    GO:0010038    response to metal ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
    GO:0051597    response to methylmercury    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a methylmercury stimulus.
    GO:0070541    response to platinum ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a platinum stimulus.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005743    mitochondrial inner membrane    The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CHD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2po5)
 
  Cis Peptide Bonds
    Ala A:155 - Pro A:156   [ RasMol ]  
    Ala B:155 - Pro B:156   [ RasMol ]  
    Gly A:312 - Pro A:313   [ RasMol ]  
    Gly B:312 - Pro B:313   [ RasMol ]  
    His A:167 - Pro A:168   [ RasMol ]  
    His B:167 - Pro B:168   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2po5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HEMH_HUMAN | P22830
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.99.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  177000
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HEMH_HUMAN | P22830
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HEMH_HUMAN | P22830: 1hrk 2hrc 2hre 2pnj 2po7 2qd1 2qd2 2qd3 2qd4 2qd5 3aqi 3hcn 3hco 3hcp 3hcr 3w1w 4f4d 4kla 4klc 4klr 4kmm 4mk4

(-) Related Entries Specified in the PDB File

1hrk 2pnj 2po7