1HRK - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN FERROCHELATASE

Authors :   C. K. Wu, H. A. Dailey, J. P. Rose, A. Burden, V. M. Sellers, B. -C. Wang

Date :   21 Dec 00 (Deposition) - 22 Jun 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Ferrochelatase, Fe2S2 Cluster, Heme Biosynthesis, Protoheme Ferro-Lyase, Mature Length, Proteolytically Processed Mitochondrial Inner Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. K. Wu, H. A. Dailey, J. P. Rose, A. Burden, V. M. Sellers, B. C. Wang
The 2. 0 A Structure Of Human Ferrochelatase, The Terminal Enzyme Of Heme Biosynthesis.
Nat. Struct. Biol. V. 8 156 2001
PubMed-ID: 11175906 | Reference-DOI: 10.1038/84152
(for further references see the PDB file header)

Molecule 1 - FERROCHELATASE
	Chains	:	A, B
	EC Number	:	4.99.1.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PHDTF20
	Expression System Strain	:	JM109
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	MATURE LENGTH
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PROTOHEME FERRO-LYASE, HEME SYNTHETASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 8)

No.	Name	Count	Type	Full Name
1	CHD	6	Ligand/Ion	CHOLIC ACID
2	FES	2	Ligand/Ion	FE2/S2 (INORGANIC) CLUSTER

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LEU A:92 , LEU A:98 , SER A:197 , HIS A:263 , LEU A:265 , PRO A:266 , VAL A:269 , TRP A:310 , CHD A:1502 , HOH A:1544 , HOH A:1559 , HOH A:1569 , HOH A:1595 , HOH A:1633 , HOH A:1763	BINDING SITE FOR RESIDUE CHD A 1501
2	AC2	SOFTWARE	MET A:99 , ARG A:114 , LEU A:115 , PRO A:266 , MET A:308 , CHD A:1501 , CHD A:1503 , HOH A:1622 , HOH A:1679 , HOH A:1685 , HOH A:1698 , HOH A:1713 , HOH A:1726	BINDING SITE FOR RESIDUE CHD A 1502
3	AC3	SOFTWARE	LEU A:107 , CHD A:1502 , HOH A:1698 , HOH A:1726 , PHE B:110	BINDING SITE FOR RESIDUE CHD A 1503
4	AC4	SOFTWARE	LEU B:92 , PHE B:93 , LEU B:98 , SER B:197 , HIS B:263 , LEU B:265 , PRO B:266 , VAL B:269 , TRP B:310 , CHD B:2502 , HOH B:3079 , HOH B:3091 , HOH B:3092 , HOH B:3094 , HOH B:3112 , HOH B:3218 , HOH B:3281	BINDING SITE FOR RESIDUE CHD B 2501
5	AC5	SOFTWARE	MET B:99 , ARG B:114 , LEU B:115 , PRO B:266 , MET B:308 , CHD B:2501 , CHD B:2503 , HOH B:3157 , HOH B:3173 , HOH B:3214 , HOH B:3219 , HOH B:3264	BINDING SITE FOR RESIDUE CHD B 2502
6	AC6	SOFTWARE	LYS A:106 , PHE A:110 , LEU B:101 , ARG B:114 , CHD B:2502 , HOH B:3173 , HOH B:3219 , HOH B:3298	BINDING SITE FOR RESIDUE CHD B 2503
7	AC7	SOFTWARE	CYS A:196 , ARG A:272 , SER A:402 , CYS A:403 , CYS A:406 , CYS A:411	BINDING SITE FOR RESIDUE FES A 1499
8	AC8	SOFTWARE	CYS B:196 , ARG B:272 , SER B:402 , CYS B:403 , CYS B:406 , CYS B:411	BINDING SITE FOR RESIDUE FES B 2999

(no "SS Bond" information available for 1HRK)

Asymmetric/Biological Unit

No.	Residues
1	Ala A:155	-	Pro A:156
2	His A:167	-	Pro A:168
3	Gly A:312	-	Pro A:313
4	Ala B:155	-	Pro B:156
5	His B:167	-	Pro B:168
6	Gly B:312	-	Pro B:313

Asymmetric/Biological Unit (22, 44)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_030554	I	71	K	HEMH_HUMAN	Disease (EPP)	---	A/B	I	71	K
02	UniProt	VAR_012028	R	96	Q	HEMH_HUMAN	Polymorphism	1041951	A/B	R	96	Q
03	UniProt	VAR_030555	Q	139	L	HEMH_HUMAN	Disease (EPP)	---	A/B	Q	139	L
04	UniProt	VAR_030556	S	151	P	HEMH_HUMAN	Disease (EPP)	---	A/B	S	151	P
05	UniProt	VAR_030557	E	178	K	HEMH_HUMAN	Disease (EPP)	---	A/B	E	178	K
06	UniProt	VAR_030558	L	182	R	HEMH_HUMAN	Disease (EPP)	---	A/B	L	182	R
07	UniProt	VAR_002384	I	186	T	HEMH_HUMAN	Disease (EPP)	---	A/B	I	186	T
08	UniProt	VAR_030559	Y	191	H	HEMH_HUMAN	Disease (EPP)	---	A/B	Y	191	H
09	UniProt	VAR_030560	P	192	T	HEMH_HUMAN	Disease (EPP)	---	A/B	P	192	T
10	UniProt	VAR_030561	C	236	Y	HEMH_HUMAN	Disease (EPP)	761962617	A/B	C	236	Y
11	UniProt	VAR_030562	F	260	L	HEMH_HUMAN	Disease (EPP)	---	A/B	F	260	L
12	UniProt	VAR_054629	S	264	L	HEMH_HUMAN	Disease (EPP)	---	A/B	S	264	L
13	UniProt	VAR_002385	M	267	I	HEMH_HUMAN	Disease (EPP)	118204037	A/B	M	267	I
14	UniProt	VAR_030563	T	283	I	HEMH_HUMAN	Disease (EPP)	---	A/B	T	283	I
15	UniProt	VAR_030564	M	288	K	HEMH_HUMAN	Disease (EPP)	---	A/B	M	288	K
16	UniProt	VAR_030565	P	334	L	HEMH_HUMAN	Disease (EPP)	150146721	A/B	P	334	L
17	UniProt	VAR_030566	V	362	G	HEMH_HUMAN	Disease (EPP)	118204040	A/B	V	362	G
18	UniProt	VAR_030567	K	379	N	HEMH_HUMAN	Disease (EPP)	---	A/B	K	379	N
19	UniProt	VAR_002386	H	386	P	HEMH_HUMAN	Disease (EPP)	---	A/B	H	386	P
20	UniProt	VAR_030568	C	406	S	HEMH_HUMAN	Disease (EPP)	---	A/B	C	406	S
21	UniProt	VAR_030569	C	406	Y	HEMH_HUMAN	Disease (EPP)	---	A/B	C	406	Y
22	UniProt	VAR_002387	F	417	S	HEMH_HUMAN	Disease (EPP)	118204039	A/B	F	417	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FERROCHELATASE	PS00534	Ferrochelatase signature.	HEMH_HUMAN	258-276	2	A:258-276 B:258-276

Asymmetric/Biological Unit (10, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000262093	1a	ENSE00001229850	chr18:55254004-55253786	219	HEMH_HUMAN	1-23	23	0	-	-
1.2a	ENST00000262093	2a	ENSE00000669631	chr18:55247431-55247305	127	HEMH_HUMAN	23-65	43	2	A:65-65 B:65-65	1 1
1.3	ENST00000262093	3	ENSE00001229830	chr18:55240597-55240478	120	HEMH_HUMAN	65-105	41	2	A:65-105 B:65-105	41 41
1.4	ENST00000262093	4	ENSE00000669629	chr18:55238772-55238624	149	HEMH_HUMAN	105-155	51	2	A:105-155 B:105-155	51 51
1.5	ENST00000262093	5	ENSE00000669628	chr18:55233813-55233679	135	HEMH_HUMAN	155-200	46	2	A:155-200 B:155-200	46 46
1.6	ENST00000262093	6	ENSE00000669627	chr18:55230212-55230106	107	HEMH_HUMAN	200-235	36	2	A:200-235 B:200-235	36 36
1.7	ENST00000262093	7	ENSE00001229801	chr18:55226475-55226377	99	HEMH_HUMAN	236-268	33	2	A:236-268 B:236-268	33 33
1.8	ENST00000262093	8	ENSE00000669625	chr18:55222184-55222077	108	HEMH_HUMAN	269-304	36	2	A:269-304 B:269-304	36 36
1.9	ENST00000262093	9	ENSE00001229786	chr18:55221656-55221492	165	HEMH_HUMAN	305-359	55	2	A:305-359 B:305-359	55 55
1.10	ENST00000262093	10	ENSE00000669622	chr18:55218606-55218547	60	HEMH_HUMAN	360-379	20	2	A:360-379 B:360-379	20 20
1.11b	ENST00000262093	11b	ENSE00001229844	chr18:55218078-55215515	2564	HEMH_HUMAN	380-423	44	2	A:380-423 B:380-423	44 44

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:359
 aligned with HEMH_HUMAN | P22830 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:359
                                    74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414         
           HEMH_HUMAN    65 RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL 423
               SCOP domains d1hrka_ A: Ferrochelatase                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1hrkA01 A:65-227,A:371-423  [code=3.40.50.1400, no name defined]                                                                                                   1hrkA02 A:228-370  [code=3.40.50.1400, no name defined]                                                                                        1hrkA01 A:65-227,A:371-423                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhheeeeeee..hhhhhh...hhhhhhhhhhhhhhhhh.....eeeeee...........hhhhhhhhhhhh...eeeeee......hhhhhh........hhhhhh...eeee......hhhhhhhhhhhhhhhhhhh....hhhhh.......hhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) ------K------------------------Q------------------------------------------L-----------P--------------------------K---R---T----HT-------------------------------------------Y-----------------------L---L--I---------------I----K---------------------------------------------L---------------------------G----------------N------P-------------------S----------S------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y----------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FERROCHELATASE     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1---------------------------------------Exon 1.4  PDB: A:105-155 UniProt: 105-155          --------------------------------------------Exon 1.6  PDB: A:200-235            Exon 1.7  PDB: A:236-268         Exon 1.8  PDB: A:269-304            Exon 1.9  PDB: A:305-359 UniProt: 305-359              Exon 1.10           Exon 1.11b  PDB: A:380-423 UniProt: 380-423  Transcript 1 (1)
           Transcript 1 (2) Exon 1.3  PDB: A:65-105 UniProt: 65-105  -------------------------------------------------Exon 1.5  PDB: A:155-200 UniProt: 155-200     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1hrk A  65 RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL 423
                                    74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414

Chain B from PDB  Type:PROTEIN  Length:359
 aligned with HEMH_HUMAN | P22830 from UniProtKB/Swiss-Prot  Length:423

    Alignment length:359
                                    74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414         
           HEMH_HUMAN    65 RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL 423
               SCOP domains d1hrkb_ B: Ferrochelatase                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1hrkB01 B:65-227,B:371-423  [code=3.40.50.1400, no name defined]                                                                                                   1hrkB02 B:228-370  [code=3.40.50.1400, no name defined]                                                                                        1hrkB01 B:65-227,B:371-423                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhheeeeeee..hhhhhh...hhhhhhhhhhhhhhhhh.....eeeeee...........hhhhhhhhhhhh...eeeeee......hhhhhh........hhhhhhh..eeee......hhhhhhhhhhhhhhhhhhh....hhhhh.......hhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) ------K------------------------Q------------------------------------------L-----------P--------------------------K---R---T----HT-------------------------------------------Y-----------------------L---L--I---------------I----K---------------------------------------------L---------------------------G----------------N------P-------------------S----------S------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y----------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FERROCHELATASE     --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1---------------------------------------Exon 1.4  PDB: B:105-155 UniProt: 105-155          --------------------------------------------Exon 1.6  PDB: B:200-235            Exon 1.7  PDB: B:236-268         Exon 1.8  PDB: B:269-304            Exon 1.9  PDB: B:305-359 UniProt: 305-359              Exon 1.10           Exon 1.11b  PDB: B:380-423 UniProt: 380-423  Transcript 1 (1)
           Transcript 1 (2) Exon 1.3  PDB: B:65-105 UniProt: 65-105  -------------------------------------------------Exon 1.5  PDB: B:155-200 UniProt: 155-200     ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1hrk B  65 RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL 423
                                    74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Chelatase-like (149)

Superfamily: Chelatase (46)

Family: Ferrochelatase (37)

Protein domain: Ferrochelatase (34)

Human (Homo sapiens) [TaxId: 9606] (17)

1a	d1hrka_	A:
1b	d1hrkb_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.1400, no name defined] (36)

Human (Homo sapiens) (15)

1a	1hrkA02	A:228-370
1b	1hrkA01	A:65-227,A:371-423
1c	1hrkB01	B:65-227,B:371-423
1d	1hrkB02	B:228-370

(no "Pfam Domain" information available for 1HRK)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (HEMH_HUMAN | P22830)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0004325	ferrochelatase activity	Catalysis of the reaction: protoheme = Fe(2+) + protoporphyrin IX.
	GO:0008198	ferrous iron binding	Interacting selectively and non-covalently with ferrous iron, Fe(II).
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0071549	cellular response to dexamethasone stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a dexamethasone stimulus.
	GO:0006091	generation of precursor metabolites and energy	The chemical reactions and pathways resulting in the formation of precursor metabolites, substances from which energy is derived, and any process involved in the liberation of energy from these substances.
	GO:0006783	heme biosynthetic process	The chemical reactions and pathways resulting in the formation of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring, from less complex precursors.
	GO:0006779	porphyrin-containing compound biosynthetic process	The chemical reactions and pathways resulting in the formation of any member of a large group of derivatives or analogs of porphyrin. Porphyrin consists of a ring of four pyrrole nuclei linked each to the next at their alpha positions through a methine group.
	GO:0046501	protoporphyrinogen IX metabolic process	The chemical reactions and pathways involving protoporphyrinogen IX, the specific substrate for the enzyme ferrochelatase, which catalyzes the insertion of iron to form protoheme. It is probably also the substrate for chlorophyll formation.
	GO:0046685	response to arsenic-containing substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an arsenic stimulus from compounds containing arsenic, including arsenates, arsenites, and arsenides.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0017085	response to insecticide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insecticide stimulus. Insecticides are chemicals used to kill insects.
	GO:0010288	response to lead ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lead ion stimulus.
	GO:0009416	response to light stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a light stimulus, electromagnetic radiation of wavelengths classified as infrared, visible or ultraviolet light.
	GO:0010038	response to metal ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
	GO:0051597	response to methylmercury	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a methylmercury stimulus.
	GO:0070541	response to platinum ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a platinum stimulus.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CHD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FES	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:155 - Pro A:156	[ RasMol ]
		Ala B:155 - Pro B:156	[ RasMol ]
		Gly A:312 - Pro A:313	[ RasMol ]
		Gly B:312 - Pro B:313	[ RasMol ]
		His A:167 - Pro A:168	[ RasMol ]
		His B:167 - Pro B:168	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1hrk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HEMH_HUMAN \| P22830
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	4.99.1.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	177000
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HEMH_HUMAN \| P22830
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1HRK)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (22, 44)

PROSITE Motifs (1, 2)

Exons (10, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (25, 25)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File