Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE FIRST HIN-200 DOMAIN OF INTERFERON-INDUCIBLE PROTEIN 16
 
Authors :  R. Lam, J. C. C. Liao, M. Ravichandran, J. Ma, W. Tempel, N. Y. Chirgadze, C. H. Arrowsmith, Northeast Structural Genomics Consortium (Ne
Date :  30 Jan 07  (Deposition) - 27 Feb 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Ob Folds, Beta-Barrels, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. C. C. Liao, R. Lam, M. Ravichandran, J. Ma, W. Tempel, N. Y. Chirgadze C. H. Arrowsmith
Crystal Structure Of The First Hin-200 Domain Of Interferon-Inducible Protein 16
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GAMMA-INTERFERON-INDUCIBLE PROTEIN IFI-16
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainCONDON-PLUS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentFIRST HIN200 DOMAIN
    GeneIFI16, IFNGIP1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymINTERFERON-INDUCIBLE MYELOID DIFFERENTIATION TRANSCRIPTIONAL ACTIVATOR, IFI 16

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 24)

Asymmetric Unit (2, 24)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2MSE23Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 5)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2MSE5Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 6)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 6)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN C:141 , GLN C:142BINDING SITE FOR RESIDUE CL C 207

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OQ0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2OQ0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 4)

Asymmetric Unit (1, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_029488K202EIF16_HUMANPolymorphism11585341A/B/C/DK15E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_029488K202EIF16_HUMANPolymorphism11585341AK15E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_029488K202EIF16_HUMANPolymorphism11585341BK15E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_029488K202EIF16_HUMANPolymorphism11585341CK15E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_029488K202EIF16_HUMANPolymorphism11585341DK15E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2OQ0)

(-) Exons   (3, 12)

Asymmetric Unit (3, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.4cENST000002958094cENSE00001446388chr1:158979712-158979951240IF16_HUMAN-00--
1.5ENST000002958095ENSE00002197956chr1:158984451-158984735285IF16_HUMAN1-89890--
1.6bENST000002958096bENSE00002145190chr1:158985662-158985777116IF16_HUMAN89-127390--
1.7bENST000002958097bENSE00001713738chr1:158986323-158986490168IF16_HUMAN128-183560--
1.8bENST000002958098bENSE00001756224chr1:158988019-158988441423IF16_HUMAN184-3241414A:12-137 (gaps)
B:12-137
C:11-137
D:13-137 (gaps)
126
126
127
125
1.9ENST000002958099ENSE00001745832chr1:158990131-158990319189IF16_HUMAN325-387634A:138-200
B:138-200
C:138-200
D:138-200
63
63
63
63
1.10ENST0000029580910ENSE00001775551chr1:159002314-159002481168IF16_HUMAN388-443564A:201-202
B:201-203
C:201-202
D:201-203
2
3
2
3
1.11ENST0000029580911ENSE00001604845chr1:159015087-159015254168IF16_HUMAN444-499560--
1.12ENST0000029580912ENSE00001647098chr1:159019222-159019389168IF16_HUMAN500-555560--
1.13aENST0000029580913aENSE00001285404chr1:159021469-159021888420IF16_HUMAN556-6951400--
1.13eENST0000029580913eENSE00001076041chr1:159023323-159023514192IF16_HUMAN696-759640--
1.14bENST0000029580914bENSE00001285450chr1:159024611-159024938328IF16_HUMAN760-785260--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:189
 aligned with IF16_HUMAN | Q16666 from UniProtKB/Swiss-Prot  Length:785

    Alignment length:191
                                   208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388 
           IF16_HUMAN   199 VLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK 389
               SCOP domains d2oq0a2 A:12-114 Gamma-  interferon-inducible protein Ifi-16                                           d2oq0a1 A:115-202 Gamma-interferon-inducible protein Ifi-16                              SCOP domains
               CATH domains 2oq0A01 A:12-113 Nuclei  c acid-binding proteins                                                      2oq0A02 A:114-202 Nucleic acid-binding proteins                                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeee...eeee..--.eeeeeeeeee....eeeeee.hhhhhhhhh....eeee..eee..eeee....eeee.hhhhh...hhhhhhhhh...hhhhhh......eeeeeeeeeeeee...eeeeeeee..eeeeeeee.hhh........eeeeeeeeeeee..eeeee.....eeee. Sec.struct. author
                 SAPs(SNPs) ---E------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.8b  PDB: A:12-137 (gaps) UniProt: 184-324 [INCOMPLETE]                                                                 Exon 1.9  PDB: A:138-200 UniProt: 325-387                      1. Transcript 1
                 2oq0 A  12 VLQKRPVIVKVLSTTKPFEYETP--EKKImFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFmLHKKTVNQKTTIYEIQDDRGKmDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQmSKLISEmHSFIQIK 202
                                    21        31  |  |  41        51        61        71        81        91       101       111       121       131  |    141       151    |  161       171       181      |191   |   201 
                                                 34 37   |                                                                                          134-MSE               156-MSE                         188-MSE  |       
                                                        41-MSE                                                                                                                                                   195-MSE   

Chain B from PDB  Type:PROTEIN  Length:192
 aligned with IF16_HUMAN | Q16666 from UniProtKB/Swiss-Prot  Length:785

    Alignment length:192
                                   208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388  
           IF16_HUMAN   199 VLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKK 390
               SCOP domains d2oq0b2 B:12-114 Gamma-interferon-inducible protein Ifi-16                                             d2oq0b1 B:115-203 Gamma-interferon-inducible protein Ifi-16                               SCOP domains
               CATH domains 2oq0B01 B:12-113 Nucleic acid-binding proteins                                                        2oq0B02 B:114-203 Nucleic acid-binding proteins                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .ee...eeeeeeee...eeee.....eeeeeeeeee....eeeeee.hhhhh.......eeeee.eeee..eeee....eeee.........hhhhhhhhhh..hhhhhh......eeeeeeeeeeeee....eeeeeee..eeeeeeehhhhh........eeeeeeeeeeee..eeeee.....eeee.. Sec.struct. author
                 SAPs(SNPs) ---E-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.8b  PDB: B:12-137 UniProt: 184-324 [INCOMPLETE]                                                                        Exon 1.9  PDB: B:138-200 UniProt: 325-387                      1.1 Transcript 1
                 2oq0 B  12 VLQKRPVIVKVLSTTKPFEYETPEmEKKImFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFmLHKKTVNQKTTIYEIQDDRGKmDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQmSKLISEmHSFIQIKK 203
                                    21        31    |   41        51        61        71        81        91       101       111       121       131  |    141       151    |  161       171       181      |191   |   201  
                                                   36-MSE|                                                                                          134-MSE               156-MSE                         188-MSE  |        
                                                        41-MSE                                                                                                                                                   195-MSE    

Chain C from PDB  Type:PROTEIN  Length:192
 aligned with IF16_HUMAN | Q16666 from UniProtKB/Swiss-Prot  Length:785

    Alignment length:192
                                   207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387  
           IF16_HUMAN   198 NVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK 389
               SCOP domains d2oq0c2 C:11-114 Gamma-interferon-inducible protein Ifi-16                                              d2oq0c1 C:115-202 Gamma-interferon-inducible protein Ifi-16                              SCOP domains
               CATH domains 2oq0C01 C:11-113 Nucleic acid-binding proteins                                                         2oq0C02 C:114-202 Nucleic acid-binding proteins                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeeeeeee...eeee.....eeeeeeeeee....eeeeee.hhhhhhhhh...eeeee..eee..eeee....eeee.........hhhhhhhhh...hhhhhh......eeeeeeeeeeeee....eeeeeee..eeeeeeehhhhh........eeeeeeeeeeee..eeeee.....eeee. Sec.struct. author
                 SAPs(SNPs) ----E------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.8b  PDB: C:11-137 UniProt: 184-324 [INCOMPLETE]                                                                         Exon 1.9  PDB: C:138-200 UniProt: 325-387                      1. Transcript 1
                 2oq0 C  11 NVLQKRPVIVKVLSTTKPFEYETPEmEKKImFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFmLHKKTVNQKTTIYEIQDDRGKmDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQmSKLISEmHSFIQIK 202
                                    20        30     |  40|       50        60        70        80        90       100       110       120       130   |   140       150     | 160       170       180       190    |  200  
                                                    36-MSE|                                                                                          134-MSE               156-MSE                         188-MSE  |       
                                                         41-MSE                                                                                                                                                   195-MSE   

Chain D from PDB  Type:PROTEIN  Length:184
 aligned with IF16_HUMAN | Q16666 from UniProtKB/Swiss-Prot  Length:785

    Alignment length:191
                                   209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389 
           IF16_HUMAN   200 LQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKK 390
               SCOP domains d2oq0d2 D:13-114 Gamma-interferon-inducible protein Ifi-16                                            d2oq0d1 D:115-203 Gamma-interferon-inducible protein Ifi-16                               SCOP domains
               CATH domains 2oq0D01 D:13-113 Nucleic acid-binding proteins                                                       2oq0D02 D:114-203 Nucleic acid-binding proteins                                            CATH domains
           Pfam domains (1) -HIN-2oq0D01 D:14-183                                                                                                                                                      -------------------- Pfam domains (1)
           Pfam domains (2) -HIN-2oq0D02 D:14-183                                                                                                                                                      -------------------- Pfam domains (2)
           Pfam domains (3) -HIN-2oq0D03 D:14-183                                                                                                                                                      -------------------- Pfam domains (3)
           Pfam domains (4) -HIN-2oq0D04 D:14-183                                                                                                                                                      -------------------- Pfam domains (4)
         Sec.struct. author .....eeeeeeee...eeee.....eeeeeeeeee....eeeeee.hhhhh........eeee..eee..eeee....eee-------...hhhhhhhhh...hhhhhh......eeeeeeeeeeeee....eeeeeee..eeeeeeehhhhh........eeeeeeeeeeee..eeeee.....eeee.. Sec.struct. author
                 SAPs(SNPs) --E-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.8b  PDB: D:13-137 (gaps) UniProt: 184-324 [INCOMPLETE]                                                                Exon 1.9  PDB: D:138-200 UniProt: 325-387                      1.1 Transcript 1
                 2oq0 D  13 LQKRPVIVKVLSTTKPFEYETPEmEKKImFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVS-------FEVPNKIINRAKETLKIDILHKQASGNIVYGVFmLHKKTVNQKTTIYEIQDDRGKmDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQmSKLISEmHSFIQIKK 203
                                    22        32   |    42        52        62        72        82        92|      102       112       122       132 |     142       152   |   162       172       182     | 192  |    202 
                                                  36-MSE|                                                  93     101                              134-MSE               156-MSE                         188-MSE  |        
                                                       41-MSE                                                                                                                                                   195-MSE    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 8)

Asymmetric Unit

(-) CATH Domains  (1, 8)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Family: HIN (1)
1aHIN-2oq0D01D:14-183
1bHIN-2oq0D02D:14-183
1cHIN-2oq0D03D:14-183
1dHIN-2oq0D04D:14-183

(-) Gene Ontology  (45, 45)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (IF16_HUMAN | Q16666)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000978    RNA polymerase II core promoter proximal region sequence-specific DNA binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
    GO:0001047    core promoter binding    Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0003690    double-stranded DNA binding    Interacting selectively and non-covalently with double-stranded DNA.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0001078    transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II (RNAP II) in order to stop, prevent, or reduce the frequency, rate or extent of transcription from an RNA polymerase II promoter.
biological process
    GO:0097202    activation of cysteine-type endopeptidase activity    Any process that initiates the activity of the inactive enzyme cysteine-type endopeptidase.
    GO:0002218    activation of innate immune response    Any process that initiates an innate immune response. Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens. Examples of this process include activation of the hypersensitive response of Arabidopsis thaliana and activation of any NOD or TLR signaling pathway in vertebrate species.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0006914    autophagy    The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0042149    cellular response to glucose starvation    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of glucose.
    GO:0071479    cellular response to ionizing radiation    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
    GO:0051607    defense response to virus    Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
    GO:0030097    hemopoiesis    The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0072332    intrinsic apoptotic signaling pathway by p53 class mediator    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, and ends when the execution phase of apoptosis is triggered.
    GO:0042771    intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
    GO:0030224    monocyte differentiation    The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of a monocyte.
    GO:0030099    myeloid cell differentiation    The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of any cell of the myeloid leukocyte, megakaryocyte, thrombocyte, or erythrocyte lineages.
    GO:0043392    negative regulation of DNA binding    Any process that stops or reduces the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
    GO:2000117    negative regulation of cysteine-type endopeptidase activity    Any process that stops, prevents, or reduces the frequency, rate or extent of cysteine-type endopeptidase activity.
    GO:0045824    negative regulation of innate immune response    Any process that stops, prevents, or reduces the frequency, rate or extent of the innate immune response.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0045071    negative regulation of viral genome replication    Any process that stops, prevents, or reduces the frequency, rate or extent of viral genome replication.
    GO:0001819    positive regulation of cytokine production    Any process that activates or increases the frequency, rate or extent of production of a cytokine.
    GO:0032731    positive regulation of interleukin-1 beta production    Any process that activates or increases the frequency, rate, or extent of interleukin-1 beta production.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0032481    positive regulation of type I interferon production    Any process that activates or increases the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
    GO:0010506    regulation of autophagy    Any process that modulates the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
    GO:0040029    regulation of gene expression, epigenetic    Any process that modulates the frequency, rate or extent of gene expression; the process is mitotically or meiotically heritable, or is stably self-propagated in the cytoplasm of a resting cell, and does not entail a change in DNA sequence.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0016607    nuclear speck    A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2oq0)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2oq0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IF16_HUMAN | Q16666
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IF16_HUMAN | Q16666
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IF16_HUMAN | Q166663b6y 3rln 3rlo 3rnu 4qgu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2OQ0)