2OGV - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE AUTOINHIBITED HUMAN C-FMS KINASE DOMAIN

Authors :   M. Walter, I. S. Lucet, O. Patel, S. E. Broughton, R. Bamert, N. K. Williams, E. Fantino, A. F. Wilks, J. Rossjohn

Date :   09 Jan 07 (Deposition) - 06 Feb 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym./Biol. Unit : A

Keywords :   Receptor Tyrosine Kinase, Macrophage Colony Stimulating Factor Receptor, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Walter, I. S. Lucet, O. Patel, S. E. Broughton, R. Bamert, N. K. Williams, E. Fantino, A. F. Wilks, J. Rossjohn
The 2. 7 A Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain.
J. Mol. Biol. V. 367 839 2007
PubMed-ID: 17292918 | Reference-DOI: 10.1016/J.JMB.2007.01.036
(for further references see the PDB file header)

Molecule 1 - MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR PRECURSOR
	Chains	:	A
	EC Number	:	2.7.10.1
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Plasmid	:	PFAST BAC HTC
	Expression System Taxid	:	7108
	Expression System Vector	:	DH10BAC
	Expression System Vector Type	:	PLASMID
	Gene	:	CSF1R, FMS
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CSF-1-R, FMS PROTO-ONCOGENE, C-FMS, CD115 ANTIGEN

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2OGV)

(no "Site" information available for 2OGV)

(no "SS Bond" information available for 2OGV)

Asymmetric/Biological Unit

No.	Residues
1	Lys A:543	-	Pro A:544
2	Ser A:555	-	Tyr A:556

Asymmetric/Biological Unit (15, 15)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_067397	G	589	E	CSF1R_HUMAN	Disease (HDLS)	281860268	A	G	589	E
02	UniProt	VAR_067398	E	633	K	CSF1R_HUMAN	Disease (HDLS)	281860269	A	E	633	K
03	UniProt	VAR_072081	C	653	R	CSF1R_HUMAN	Disease (HDLS)	690016559	A	C	653	R
04	UniProt	VAR_067400	G	747	R	CSF1R_HUMAN	Polymorphism	41355444	A	G	747	R
05	UniProt	VAR_067401	M	766	T	CSF1R_HUMAN	Disease (HDLS)	281860270	A	M	766	T
06	UniProt	VAR_067402	A	770	P	CSF1R_HUMAN	Disease (HDLS)	281860271	A	A	770	P
07	UniProt	VAR_067404	I	775	N	CSF1R_HUMAN	Disease (HDLS)	281860273	A	I	775	N
08	UniProt	VAR_067405	I	794	T	CSF1R_HUMAN	Disease (HDLS)	281860274	A	I	794	T
09	UniProt	VAR_067406	D	837	Y	CSF1R_HUMAN	Disease (HDLS)	387906662	A	D	837	Y
10	UniProt	VAR_072082	I	843	F	CSF1R_HUMAN	Disease (HDLS)	690016558	A	I	843	F
11	UniProt	VAR_067407	F	849	S	CSF1R_HUMAN	Disease (HDLS)	281860277	A	F	849	S
12	UniProt	VAR_067409	L	868	P	CSF1R_HUMAN	Disease (HDLS)	281860278	A	L	868	P
13	UniProt	VAR_067410	M	875	T	CSF1R_HUMAN	Disease (HDLS)	281860279	A	M	875	T
14	UniProt	VAR_067411	P	878	T	CSF1R_HUMAN	Disease (HDLS)	281860280	A	P	878	T
15	UniProt	VAR_072083	I	906	T	CSF1R_HUMAN	Disease (HDLS)	690016560	A	I	906	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	CSF1R_HUMAN	588-616	1	A:588-616
2	RECEPTOR_TYR_KIN_III	PS00240	Receptor tyrosine kinase class III signature.	CSF1R_HUMAN	641-654	1	A:641-654
3	PROTEIN_KINASE_TYR	PS00109	Tyrosine protein kinases specific active-site signature.	CSF1R_HUMAN	774-786	1	A:774-786

Asymmetric/Biological Unit (10, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000286301	1	ENSE00000841168	chr5:149492935-149492824	112	CSF1R_HUMAN	-	0	0	-	-
1.2b	ENST00000286301	2b	ENSE00001366842	chr5:149466170-149465942	229	CSF1R_HUMAN	1-17	17	0	-	-
1.3	ENST00000286301	3	ENSE00001023095	chr5:149460587-149460330	258	CSF1R_HUMAN	17-103	87	0	-	-
1.4	ENST00000286301	4	ENSE00001023084	chr5:149459899-149459615	285	CSF1R_HUMAN	103-198	96	0	-	-
1.5	ENST00000286301	5	ENSE00001023099	chr5:149457811-149457675	137	CSF1R_HUMAN	198-243	46	0	-	-
1.6a	ENST00000286301	6a	ENSE00001023081	chr5:149456998-149456839	160	CSF1R_HUMAN	244-297	54	0	-	-
1.7	ENST00000286301	7	ENSE00001023101	chr5:149453056-149452864	193	CSF1R_HUMAN	297-361	65	0	-	-
1.8	ENST00000286301	8	ENSE00001023092	chr5:149450134-149450019	116	CSF1R_HUMAN	361-400	40	0	-	-
1.9	ENST00000286301	9	ENSE00001023097	chr5:149449865-149449745	121	CSF1R_HUMAN	400-440	41	0	-	-
1.10	ENST00000286301	10	ENSE00001023094	chr5:149449626-149449436	191	CSF1R_HUMAN	440-504	65	0	-	-
1.11	ENST00000286301	11	ENSE00001023090	chr5:149447893-149447778	116	CSF1R_HUMAN	504-542	39	0	-	-
1.13a	ENST00000286301	13a	ENSE00001023078	chr5:149441412-149441286	127	CSF1R_HUMAN	543-585	43	1	A:543-585	43
1.13d	ENST00000286301	13d	ENSE00001023098	chr5:149441158-149441054	105	CSF1R_HUMAN	585-620	36	1	A:585-620	36
1.14	ENST00000286301	14	ENSE00001023088	chr5:149440535-149440425	111	CSF1R_HUMAN	620-657	38	1	A:620-657	38
1.15b	ENST00000286301	15b	ENSE00001023096	chr5:149439425-149439263	163	CSF1R_HUMAN	657-711	55	1	A:657-681	25
1.17	ENST00000286301	17	ENSE00001023083	chr5:149437155-149437067	89	CSF1R_HUMAN	711-741	31	1	A:741-741	1
1.18	ENST00000286301	18	ENSE00001023077	chr5:149436947-149436850	98	CSF1R_HUMAN	741-773	33	1	A:741-773	33
1.19	ENST00000286301	19	ENSE00001023079	chr5:149435904-149435782	123	CSF1R_HUMAN	774-814	41	1	A:774-814	41
1.20	ENST00000286301	20	ENSE00001684899	chr5:149435700-149435589	112	CSF1R_HUMAN	815-852	38	1	A:815-852	38
1.21	ENST00000286301	21	ENSE00001023100	chr5:149434899-149434800	100	CSF1R_HUMAN	852-885	34	1	A:852-885	34
1.22b	ENST00000286301	22b	ENSE00001023085	chr5:149433993-149433885	109	CSF1R_HUMAN	885-921	37	1	A:885-918	34
1.23c	ENST00000286301	23c	ENSE00001083274	chr5:149433787-149432854	934	CSF1R_HUMAN	922-972	51	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:317
 aligned with CSF1R_HUMAN | P07333 from UniProtKB/Swiss-Prot  Length:972

    Alignment length:376
                                   552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912      
          CSF1R_HUMAN   543 KPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQEDR 918
               SCOP domains d2ogva_ A: automated matches                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains -------------------2ogvA01 A:562-665 Phosphorylase Kinase; domain 1                                                        2ogvA02 A:666-91                                                           0 Transferase(Phosphotransferase) domain 1                                                                                                                                -------- CATH domains
               Pfam domains ---------------------------------------Pkinase_Tyr-2ogvA01 A:582-910                                                                                                                                                                                                                                                                                                            -------- Pfam domains
         Sec.struct. author ..........eeee....eee.hhhhh..hhhhh.hhh.eeeeeeeee...eeeeeeeee.......eeeeeeeee.........hhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhhhh.-----------------------------------------------------------..........hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee.......hhhhh...eee..eeehhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.............hhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------E-------------------------------------------K-------------------R---------------------------------------------------------------------------------------------R------------------T---P----N------------------T------------------------------------------Y-----F-----S------------------P------T--T---------------------------T------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------PROTEIN_KINASE_ATP           ------------------------RECEPTOR_TYR_K-----------------------------------------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.13a  PDB: A:543-585 UniProt: 543-585----------------------------------Exon 1.14  PDB: A:620-657             -----------------------------------------------------Exon 1.17  PDB: A:741-741      --------------------------------Exon 1.19  PDB: A:774-814                Exon 1.20  PDB: A:815-852             --------------------------------Exon 1.22b  PDB: A:885-918         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.13d  PDB: A:585-620          ------------------------------------Exon 1.15b  PDB: A:657-681 UniProt: 657-711            -----------------------------Exon 1.18  PDB: A:741-773        ------------------------------------------------------------------------------Exon 1.21  PDB: A:852-885         --------------------------------- Transcript 1 (2)
                 2ogv A 543 KPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEA-----------------------------------------------------------DLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQEDR 918
                                   552       562       572       582       592       602       612       622       632       642       652       662       672        |-         -         -         -         -         -       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912      
                                                                                                                                                                    681                                                         741

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Protein kinase-like (PK-like) (2589)

Superfamily: Protein kinase-like (PK-like) (2589)

Family: Protein kinases, catalytic subunit (1977)

Protein domain: automated matches (542)

Human (Homo sapiens) [TaxId: 9606] (452)

d2ogva_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Phosphorylase Kinase; domain 1 (1392)

Homologous Superfamily: Phosphorylase Kinase; domain 1 (1392)

Human (Homo sapiens) (1036)

2ogvA01

A:562-665

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Transferase(Phosphotransferase); domain 1 (1379)

Homologous Superfamily: Transferase(Phosphotransferase) domain 1 (1379)

Human (Homo sapiens) (1049)

2ogvA02

A:666-910

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PKinase (934)

Family: Pkinase_Tyr (229)

Homo sapiens (Human) (202)

Pkinase_Tyr-2ogvA01

A:582-910

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (CSF1R_HUMAN | P07333)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0019955	cytokine binding	Interacting selectively and non-covalently with a cytokine, any of a group of proteins that function to control the survival, growth and differentiation of tissues and cells, and which have autocrine and paracrine activity.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0005011	macrophage colony-stimulating factor receptor activity	Combining with macrophage colony-stimulating factor (M-CSF) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0019903	protein phosphatase binding	Interacting selectively and non-covalently with any protein phosphatase.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004714	transmembrane receptor protein tyrosine kinase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0045217	cell-cell junction maintenance	The maintenance of junctions between cells.
	GO:0071345	cellular response to cytokine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0036006	cellular response to macrophage colony-stimulating factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a macrophage colony-stimulating factor stimulus.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0021879	forebrain neuron differentiation	The process in which a relatively unspecialized cell acquires specialized features of a neuron that will reside in the forebrain.
	GO:0030097	hemopoiesis	The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0038145	macrophage colony-stimulating factor signaling pathway	A series of molecular signals initiated by the binding of the cytokine macrophage colony-stimulating factor (M-CSF) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0030225	macrophage differentiation	The process in which a relatively unspecialized monocyte acquires the specialized features of a macrophage.
	GO:0060603	mammary gland duct morphogenesis	The process in which anatomical structures of the mammary ducts are generated and organized. Mammary ducts are epithelial tubes that transport milk.
	GO:0030224	monocyte differentiation	The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of a monocyte.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0021772	olfactory bulb development	The progression of the olfactory bulb over time from its initial formation until its mature state. The olfactory bulb coordinates neuronal signaling involved in the perception of smell. It receives input from the sensory neurons and outputs to the olfactory cortex.
	GO:0030316	osteoclast differentiation	The process in which a relatively unspecialized monocyte acquires the specialized features of an osteoclast. An osteoclast is a specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0046488	phosphatidylinositol metabolic process	The chemical reactions and pathways involving phosphatidylinositol, any glycophospholipid in which a sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:2000147	positive regulation of cell motility	Any process that activates or increases the frequency, rate or extent of cell motility.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0090197	positive regulation of chemokine secretion	Any process that increases the rate, frequency or extent of chemokine secretion, the regulated release of chemokines from a cell.
	GO:0045672	positive regulation of osteoclast differentiation	Any process that activates or increases the frequency, rate or extent of osteoclast differentiation.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0071902	positive regulation of protein serine/threonine kinase activity	Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
	GO:0061098	positive regulation of protein tyrosine kinase activity	Any process that increases the rate, frequency, or extent of protein tyrosine kinase activity.
	GO:0046777	protein autophosphorylation	The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:2000249	regulation of actin cytoskeleton reorganization	Any process that modulates the frequency, rate or extent of actin cytoskeleton reorganization.
	GO:0045124	regulation of bone resorption	Any process that modulates the frequency, rate or extent of bone tissue loss (resorption).
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
	GO:0031529	ruffle organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a ruffle, a projection at the leading edge of a crawling cell.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007519	skeletal muscle tissue development	The developmental sequence of events leading to the formation of adult skeletal muscle tissue. The main events are: the fusion of myoblasts to form myotubes that increase in size by further fusion to them of myoblasts, the formation of myofibrils within their cytoplasm and the establishment of functional neuromuscular junctions with motor neurons. At this stage they can be regarded as mature muscle fibers.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:1990682	CSF1-CSF1R complex	A protein complex consisting of a macrophage colony-stimulating factor (CSF1, also called M-CSF) dimer bound to a dimerized receptor (CSF1R, also called FMS). Receptor dimerization requires the presence of the ligand.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ogv)

	Sites
(no "Sites" information available for 2ogv)

	Cis Peptide Bonds
		Lys A:543 - Pro A:544	[ RasMol ]
		Ser A:555 - Tyr A:556	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ogv
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CSF1R_HUMAN \| P07333
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.10.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	221820
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CSF1R_HUMAN \| P07333
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 2OGV)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (15, 15)

PROSITE Motifs (3, 3)

Exons (10, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (2, 2)

Pfam Domains (1, 1)

Gene Ontology (60, 60)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File