Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  C-FMS TYROSINE KINASE IN COMPLEX WITH A QUINOLONE INHIBITOR
 
Authors :  C. Schubert, C. Schalk-Hihi
Date :  11 Aug 06  (Deposition) - 28 Nov 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Receptor Tyrosine Kinase, Kinase-Inhibitor Complex, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Schubert, C. Schalk-Hihi, G. T. Struble, H. C. Ma, I. P. Petrounia, B. Brandt, I. C. Deckman, R. J. Patch, M. R. Player, J. C. Spurlino, B. A. Springer
Crystal Structure Of The Tyrosine Kinase Domain Of Colony-Stimulating Factor-1 Receptor (Cfms) In Complex With Two Inhibitors.
J. Biol. Chem. V. 282 4094 2007
PubMed-ID: 17132624  |  Reference-DOI: 10.1074/JBC.M608183200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CFMS TYROSINE KINASE
    ChainsA
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    FragmentKINASE DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
16C31Ligand/Ion6-CHLORO-3-(3-METHYLISOXAZOL-5-YL)-4-PHENYLQUINOLIN-2(1H)-ONE
2SO41Ligand/IonSULFATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:676 , ASN A:808 , ASN A:854BINDING SITE FOR RESIDUE SO4 A 101
2AC2SOFTWARELEU A:588 , ALA A:614 , LYS A:616 , THR A:663 , GLU A:664 , TYR A:665 , CYS A:666 , LEU A:785 , ASP A:796 , ALA A:800BINDING SITE FOR RESIDUE 6C3 A 1000

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2I0V)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2I0V)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (14, 14)

Asymmetric/Biological Unit (14, 14)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_067397G589ECSF1R_HUMANDisease (HDLS)281860268AG589E
02UniProtVAR_067398E633KCSF1R_HUMANDisease (HDLS)281860269AE633K
03UniProtVAR_072081C653RCSF1R_HUMANDisease (HDLS)690016559AC653R
04UniProtVAR_067401M766TCSF1R_HUMANDisease (HDLS)281860270AM766T
05UniProtVAR_067402A770PCSF1R_HUMANDisease (HDLS)281860271AA770P
06UniProtVAR_067404I775NCSF1R_HUMANDisease (HDLS)281860273AI775N
07UniProtVAR_067405I794TCSF1R_HUMANDisease (HDLS)281860274AI794T
08UniProtVAR_067406D837YCSF1R_HUMANDisease (HDLS)387906662AD837Y
09UniProtVAR_072082I843FCSF1R_HUMANDisease (HDLS)690016558AI843F
10UniProtVAR_067407F849SCSF1R_HUMANDisease (HDLS)281860277AF849S
11UniProtVAR_067409L868PCSF1R_HUMANDisease (HDLS)281860278AL868P
12UniProtVAR_067410M875TCSF1R_HUMANDisease (HDLS)281860279AM875T
13UniProtVAR_067411P878TCSF1R_HUMANDisease (HDLS)281860280AP878T
14UniProtVAR_072083I906TCSF1R_HUMANDisease (HDLS)690016560AI906T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 3)

Asymmetric/Biological Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.CSF1R_HUMAN588-616  1A:588-616
2RECEPTOR_TYR_KIN_IIIPS00240 Receptor tyrosine kinase class III signature.CSF1R_HUMAN641-654  1A:641-654
3PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.CSF1R_HUMAN774-786  1A:774-786

(-) Exons   (9, 9)

Asymmetric/Biological Unit (9, 9)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002863011ENSE00000841168chr5:149492935-149492824112CSF1R_HUMAN-00--
1.2bENST000002863012bENSE00001366842chr5:149466170-149465942229CSF1R_HUMAN1-17170--
1.3ENST000002863013ENSE00001023095chr5:149460587-149460330258CSF1R_HUMAN17-103870--
1.4ENST000002863014ENSE00001023084chr5:149459899-149459615285CSF1R_HUMAN103-198960--
1.5ENST000002863015ENSE00001023099chr5:149457811-149457675137CSF1R_HUMAN198-243460--
1.6aENST000002863016aENSE00001023081chr5:149456998-149456839160CSF1R_HUMAN244-297540--
1.7ENST000002863017ENSE00001023101chr5:149453056-149452864193CSF1R_HUMAN297-361650--
1.8ENST000002863018ENSE00001023092chr5:149450134-149450019116CSF1R_HUMAN361-400400--
1.9ENST000002863019ENSE00001023097chr5:149449865-149449745121CSF1R_HUMAN400-440410--
1.10ENST0000028630110ENSE00001023094chr5:149449626-149449436191CSF1R_HUMAN440-504650--
1.11ENST0000028630111ENSE00001023090chr5:149447893-149447778116CSF1R_HUMAN504-542390--
1.13aENST0000028630113aENSE00001023078chr5:149441412-149441286127CSF1R_HUMAN543-585431A:544-58542
1.13dENST0000028630113dENSE00001023098chr5:149441158-149441054105CSF1R_HUMAN585-620361A:585-62036
1.14ENST0000028630114ENSE00001023088chr5:149440535-149440425111CSF1R_HUMAN620-657381A:620-65738
1.15bENST0000028630115bENSE00001023096chr5:149439425-149439263163CSF1R_HUMAN657-711551A:657-699 (gaps)43
1.17ENST0000028630117ENSE00001023083chr5:149437155-14943706789CSF1R_HUMAN711-741310--
1.18ENST0000028630118ENSE00001023077chr5:149436947-14943685098CSF1R_HUMAN741-773331A:753-77321
1.19ENST0000028630119ENSE00001023079chr5:149435904-149435782123CSF1R_HUMAN774-814411A:774-81340
1.20ENST0000028630120ENSE00001684899chr5:149435700-149435589112CSF1R_HUMAN815-852381A:815-85238
1.21ENST0000028630121ENSE00001023100chr5:149434899-149434800100CSF1R_HUMAN852-885341A:852-88534
1.22bENST0000028630122bENSE00001023085chr5:149433993-149433885109CSF1R_HUMAN885-921371A:885-91632
1.23cENST0000028630123cENSE00001083274chr5:149433787-149432854934CSF1R_HUMAN922-972510--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:303
 aligned with CSF1R_HUMAN | P07333 from UniProtKB/Swiss-Prot  Length:972

    Alignment length:373
                                   553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913   
          CSF1R_HUMAN   544 PKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQE 916
               SCOP domains d2i0va_ A: automated matches                                                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ------------------2i0vA01 A:562-665 Phosphorylase Kinase; domain 1                                                        2i0vA02 A:666-      910                                                                Transferase(Phosphotransferase) domain 1                                                                                                                      ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee............hhhhh........hhh.eeeeeeeeee..eeeeeeee..........eeeeeee....hhhhhhhhhhhhhhhhhhh.......eeee.......eeee......hhhhhhh...------..hh---------------------------------------------------------------hhhhhhhhhhhhhhhhhhh..ee....hhhhh..hhhhh..........hhhhh...ee..-.ee.....hhhhhhhh..hhhhhhhhhhhhhhhhhh...........hhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------E-------------------------------------------K-------------------R----------------------------------------------------------------------------------------------------------------T---P----N------------------T------------------------------------------Y-----F-----S------------------P------T--T---------------------------T---------- SAPs(SNPs)
                    PROSITE --------------------------------------------PROTEIN_KINASE_ATP           ------------------------RECEPTOR_TYR_K-----------------------------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.13a  PDB: A:544-585 [INCOMPLETE]   ----------------------------------Exon 1.14  PDB: A:620-657             -----------------------------------------------------Exon 1.17  PDB: -              --------------------------------Exon 1.19  PDB: A:774-813 [INCOMPLETE]   Exon 1.20  PDB: A:815-852             --------------------------------Exon 1.22b  PDB: A:885-916       Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.13d  PDB: A:585-620          ------------------------------------Exon 1.15b  PDB: A:657-699 (gaps) UniProt: 657-711     -----------------------------Exon 1.18  PDB: A:753-773        ------------------------------------------------------------------------------Exon 1.21  PDB: A:852-885         ------------------------------- Transcript 1 (2)
                 2i0v A 544 PKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKR------QLSS---------------------------------------------------------------RDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKG-ARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQE 916
                                   553       563       573       583       593       603       613       623       633       643       653       663       673     |   -  |  |   -         -         -         -         -         -       753       763       773       783       793       803       813 |     823       833       843       853       863       873       883       893       903       913   
                                                                                                                                                                 679    696  |                                                             753                                                         813 |                                                                                                     
                                                                                                                                                                           699                                                                                                                           815                                                                                                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I0V)

(-) Gene Ontology  (60, 60)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CSF1R_HUMAN | P07333)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0019955    cytokine binding    Interacting selectively and non-covalently with a cytokine, any of a group of proteins that function to control the survival, growth and differentiation of tissues and cells, and which have autocrine and paracrine activity.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0005011    macrophage colony-stimulating factor receptor activity    Combining with macrophage colony-stimulating factor (M-CSF) and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0019903    protein phosphatase binding    Interacting selectively and non-covalently with any protein phosphatase.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0007411    axon guidance    The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0045217    cell-cell junction maintenance    The maintenance of junctions between cells.
    GO:0071345    cellular response to cytokine stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
    GO:0036006    cellular response to macrophage colony-stimulating factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a macrophage colony-stimulating factor stimulus.
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0021879    forebrain neuron differentiation    The process in which a relatively unspecialized cell acquires specialized features of a neuron that will reside in the forebrain.
    GO:0030097    hemopoiesis    The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0038145    macrophage colony-stimulating factor signaling pathway    A series of molecular signals initiated by the binding of the cytokine macrophage colony-stimulating factor (M-CSF) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0030225    macrophage differentiation    The process in which a relatively unspecialized monocyte acquires the specialized features of a macrophage.
    GO:0060603    mammary gland duct morphogenesis    The process in which anatomical structures of the mammary ducts are generated and organized. Mammary ducts are epithelial tubes that transport milk.
    GO:0030224    monocyte differentiation    The process in which a relatively unspecialized myeloid precursor cell acquires the specialized features of a monocyte.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0021772    olfactory bulb development    The progression of the olfactory bulb over time from its initial formation until its mature state. The olfactory bulb coordinates neuronal signaling involved in the perception of smell. It receives input from the sensory neurons and outputs to the olfactory cortex.
    GO:0030316    osteoclast differentiation    The process in which a relatively unspecialized monocyte acquires the specialized features of an osteoclast. An osteoclast is a specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0046488    phosphatidylinositol metabolic process    The chemical reactions and pathways involving phosphatidylinositol, any glycophospholipid in which a sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
    GO:0048015    phosphatidylinositol-mediated signaling    A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:2000147    positive regulation of cell motility    Any process that activates or increases the frequency, rate or extent of cell motility.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0090197    positive regulation of chemokine secretion    Any process that increases the rate, frequency or extent of chemokine secretion, the regulated release of chemokines from a cell.
    GO:0045672    positive regulation of osteoclast differentiation    Any process that activates or increases the frequency, rate or extent of osteoclast differentiation.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0071902    positive regulation of protein serine/threonine kinase activity    Any process that increases the rate, frequency, or extent of protein serine/threonine kinase activity.
    GO:0061098    positive regulation of protein tyrosine kinase activity    Any process that increases the rate, frequency, or extent of protein tyrosine kinase activity.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:2000249    regulation of actin cytoskeleton reorganization    Any process that modulates the frequency, rate or extent of actin cytoskeleton reorganization.
    GO:0045124    regulation of bone resorption    Any process that modulates the frequency, rate or extent of bone tissue loss (resorption).
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
    GO:0031529    ruffle organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a ruffle, a projection at the leading edge of a crawling cell.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007519    skeletal muscle tissue development    The developmental sequence of events leading to the formation of adult skeletal muscle tissue. The main events are: the fusion of myoblasts to form myotubes that increase in size by further fusion to them of myoblasts, the formation of myofibrils within their cytoplasm and the establishment of functional neuromuscular junctions with motor neurons. At this stage they can be regarded as mature muscle fibers.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:1990682    CSF1-CSF1R complex    A protein complex consisting of a macrophage colony-stimulating factor (CSF1, also called M-CSF) dimer bound to a dimerized receptor (CSF1R, also called FMS). Receptor dimerization requires the presence of the ligand.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6C3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2i0v)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i0v
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CSF1R_HUMAN | P07333
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  221820
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CSF1R_HUMAN | P07333
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CSF1R_HUMAN | P073332i0y 2i1m 2ogv 3bea 3dpk 3krj 3krl 3lcd 3lco 4dkd 4hw7 4liq 4r7h 4r7i 4wrl 4wrm

(-) Related Entries Specified in the PDB File

2i0y