2NLH - JenaLib

Title :   HUMAN BETA-DEFENSIN-1 (MUTANT GLN24ALA)

Authors :   J. Lubkowski, M. Pazgier

Date :   20 Oct 06 (Deposition) - 31 Oct 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.85

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: A (1x),B (1x),C (1x),D (1x)
Biol. Unit 6: B (1x),D (1x)
Biol. Unit 7: A,C  (1x)
Biol. Unit 8: B (1x),C (1x)
Biol. Unit 9: A (1x),D (1x)

Keywords :   Antimicrobial, Chemotactic, Defensin, Mutant, Antimicrobial Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Pazgier, A. Prahl, D. M. Hoover, J. Lubkowski
Studies Of The Biological Properties Of Human Beta-Defensin 1.
J. Biol. Chem. V. 282 1819 2007
PubMed-ID: 17071614 | Reference-DOI: 10.1074/JBC.M607210200
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 7)

Asymmetric Unit (2, 7)

No.	Name	Count	Type	Full Name
1	ACT	1	Ligand/Ion	ACETATE ION
2	SO4	6	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 3)

No.	Name	Count	Type	Full Name
1	ACT	-1	Ligand/Ion	ACETATE ION
2	SO4	3	Ligand/Ion	SULFATE ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	ACT	-1	Ligand/Ion	ACETATE ION
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 3 (2, 2)

No.	Name	Count	Type	Full Name
1	ACT	1	Ligand/Ion	ACETATE ION
2	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 4 (0, 0)

No.	Name	Count	Type	Full Name
1	ACT	-1	Ligand/Ion	ACETATE ION
2	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 5 (0, 0)

No.	Name	Count	Type	Full Name
1	ACT	-1	Ligand/Ion	ACETATE ION
2	SO4	-1	Ligand/Ion	SULFATE ION

Biological Unit 6 (1, 2)

No.	Name	Count	Type	Full Name
1	ACT	-1	Ligand/Ion	ACETATE ION
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 7 (2, 5)

No.	Name	Count	Type	Full Name
1	ACT	1	Ligand/Ion	ACETATE ION
2	SO4	4	Ligand/Ion	SULFATE ION

Biological Unit 8 (2, 2)

No.	Name	Count	Type	Full Name
1	ACT	1	Ligand/Ion	ACETATE ION
2	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 9 (1, 3)

No.	Name	Count	Type	Full Name
1	ACT	-1	Ligand/Ion	ACETATE ION
2	SO4	3	Ligand/Ion	SULFATE ION

Sites (7, 7)

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP B:1 , HIS B:2 , CYS B:27 , TYR B:28 , ARG B:29 , HOH B:105 , HOH B:117 , HOH B:145 , TYR D:3	BINDING SITE FOR RESIDUE SO4 B 401
2	AC2	SOFTWARE	TYR B:3 , HOH B:105 , HOH B:117 , HOH B:126 , HOH B:143 , HOH B:194 , ASP D:1 , HIS D:2 , CYS D:27 , TYR D:28 , ARG D:29	BINDING SITE FOR RESIDUE SO4 B 402
3	AC3	SOFTWARE	TYR A:3 , ASP C:1 , HIS C:2 , CYS C:27 , TYR C:28 , ARG C:29 , HOH C:101 , HOH C:123 , HOH C:142 , HOH C:269	BINDING SITE FOR RESIDUE SO4 C 403
4	AC4	SOFTWARE	ASP A:1 , HIS A:2 , CYS A:27 , TYR A:28 , ARG A:29 , HOH A:107 , HOH A:113 , HOH A:121 , HOH A:153 , TYR C:3	BINDING SITE FOR RESIDUE SO4 A 404
5	AC5	SOFTWARE	ASP A:1 , GLY A:25 , THR A:26 , HOH A:130 , HOH A:291	BINDING SITE FOR RESIDUE SO4 A 405
6	AC6	SOFTWARE	ARG A:29 , HOH A:224 , ASP C:1 , ASN C:4 , ACT C:501	BINDING SITE FOR RESIDUE SO4 A 406
7	AC7	SOFTWARE	ARG A:29 , SO4 A:406 , ASN C:4 , HOH C:218	BINDING SITE FOR RESIDUE ACT C 501

SS Bonds (12, 12)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 12)

Asymmetric Unit (3, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	A/B/C/D	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	A/B/C/D	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	A/B/C/D	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	A	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	A	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	A	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	B	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	B	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	B	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	C	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	C	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	C	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	D	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	D	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	D	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (3, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	A/B/C/D	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	A/B/C/D	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	A/B/C/D	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	B/D	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	B/D	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	B/D	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 7 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	A/C	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	A/C	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	A/C	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 8 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	B/C	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	B/C	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	B/C	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 9 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_018405	V	38	I	DEFB1_HUMAN	Polymorphism	2738047	A/D	V	6	I
2	UniProt	VAR_014925	A	48	V	DEFB1_HUMAN	Polymorphism	1800967	A/D	A	16	V
3	UniProt	VAR_014926	C	67	S	DEFB1_HUMAN	Polymorphism	1800968	A/D	C	35	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (1, 4)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:36
 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot  Length:68

    Alignment length:36
                                    42        52        62      
           DEFB1_HUMAN   33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68
               SCOP domains d2nlha_ A: automated matches         SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhh..eee.........eeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
               Transcript 1 Exon 1.2  PDB: A:1-36 UniProt: 21-68 Transcript 1
                  2nlh A  1 DHYNCVSSGGQCLYSACPIFTKIAGTCYRGKAKCCK 36
                                    10        20        30

Chain B from PDB  Type:PROTEIN  Length:36
 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot  Length:68

    Alignment length:36
                                    42        52        62      
           DEFB1_HUMAN   33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68
               SCOP domains d2nlhb_ B: automated matches         SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhh..eee.........eeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
               Transcript 1 Exon 1.2  PDB: B:1-36 UniProt: 21-68 Transcript 1
                  2nlh B  1 DHYNCVSSGGQCLYSACPIFTKIAGTCYRGKAKCCK 36
                                    10        20        30

Chain C from PDB  Type:PROTEIN  Length:36
 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot  Length:68

    Alignment length:36
                                    42        52        62      
           DEFB1_HUMAN   33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68
               SCOP domains d2nlhc_ C: automated matches         SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhh..eee.........eeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
               Transcript 1 Exon 1.2  PDB: C:1-36 UniProt: 21-68 Transcript 1
                  2nlh C  1 DHYNCVSSGGQCLYSACPIFTKIAGTCYRGKAKCCK 36
                                    10        20        30

Chain D from PDB  Type:PROTEIN  Length:36
 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot  Length:68

    Alignment length:36
                                    42        52        62      
           DEFB1_HUMAN   33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68
               SCOP domains d2nlhd_ D: automated matches         SCOP domains
               CATH domains ------------------------------------ CATH domains
           Pfam domains (1) Defensin_beta-2nlhD01 D:1-36         Pfam domains (1)
           Pfam domains (2) Defensin_beta-2nlhD02 D:1-36         Pfam domains (2)
           Pfam domains (3) Defensin_beta-2nlhD03 D:1-36         Pfam domains (3)
           Pfam domains (4) Defensin_beta-2nlhD04 D:1-36         Pfam domains (4)
         Sec.struct. author hhhhhhhh..eee.........eeeee....eeee. Sec.struct. author
                 SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
               Transcript 1 Exon 1.2  PDB: D:1-36 UniProt: 21-68 Transcript 1
                  2nlh D  1 DHYNCVSSGGQCLYSACPIFTKIAGTCYRGKAKCCK 36
                                    10        20        30

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (16, 16)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (DEFB1_HUMAN | P60022)

biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0002526	acute inflammatory response	Inflammation which comprises a rapid, short-lived, relatively uniform response to acute injury or antigenic challenge and is characterized by accumulations of fluid, plasma proteins, and granulocytic leukocytes. An acute inflammatory response occurs within a matter of minutes or hours, and either resolves within a few days or becomes a chronic inflammatory response.
	GO:0019731	antibacterial humoral response	An immune response against bacteria mediated through a body fluid. Examples of this process are the antibacterial humoral responses in Mus musculus and Drosophila melanogaster.
	GO:0006935	chemotaxis	The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0006952	defense response	Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
	GO:0050830	defense response to Gram-positive bacterium	Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.
	GO:0042742	defense response to bacterium	Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0002227	innate immune response in mucosa	Any process of the innate immune response that takes place in the mucosal tissues.
	GO:0009617	response to bacterium	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a bacterium.
	GO:0033574	response to testosterone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a testosterone stimulus.
cellular component
	GO:0005796	Golgi lumen	The volume enclosed by the membranes of any cisterna or subcompartment of the Golgi apparatus, including the cis- and trans-Golgi networks.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2nlh)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]
		Biological Unit 7	[ Jena3D ]
		Biological Unit 8	[ Jena3D ]
		Biological Unit 9	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2nlh
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DEFB1_HUMAN \| P60022
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description