![]() |
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 8)
|
Asymmetric Unit (8, 8)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2NLG) |
Asymmetric Unit (3, 12)
|
(no "PROSITE Motif" information available for 2NLG) |
Asymmetric Unit (1, 4)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:36 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot Length:68 Alignment length:36 42 52 62 DEFB1_HUMAN 33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68 SCOP domains d2nlga_ A: automated matches SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: A:1-36 UniProt: 21-68 Transcript 1 2nlg A 1 DHYNCVSSGGQCLYSACPIFTEIQGTCYRGKAKCCK 36 10 20 30 Chain B from PDB Type:PROTEIN Length:36 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot Length:68 Alignment length:36 42 52 62 DEFB1_HUMAN 33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68 SCOP domains d2nlgb_ B: automated matches SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: B:1-36 UniProt: 21-68 Transcript 1 2nlg B 1 DHYNCVSSGGQCLYSACPIFTEIQGTCYRGKAKCCK 36 10 20 30 Chain C from PDB Type:PROTEIN Length:36 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot Length:68 Alignment length:36 42 52 62 DEFB1_HUMAN 33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68 SCOP domains d2nlgc_ C: automated matches SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: C:1-36 UniProt: 21-68 Transcript 1 2nlg C 1 DHYNCVSSGGQCLYSACPIFTEIQGTCYRGKAKCCK 36 10 20 30 Chain D from PDB Type:PROTEIN Length:36 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot Length:68 Alignment length:36 42 52 62 DEFB1_HUMAN 33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68 SCOP domains d2nlgd_ D: automated matches SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains (1) Defensin_beta-2nlgD01 D:1-36 Pfam domains (1) Pfam domains (2) Defensin_beta-2nlgD02 D:1-36 Pfam domains (2) Pfam domains (3) Defensin_beta-2nlgD03 D:1-36 Pfam domains (3) Pfam domains (4) Defensin_beta-2nlgD04 D:1-36 Pfam domains (4) SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: D:1-36 UniProt: 21-68 Transcript 1 2nlg D 1 DHYNCVSSGGQCLYSACPIFTEIQGTCYRGKAKCCK 36 10 20 30
|
Asymmetric Unit |
(no "CATH Domain" information available for 2NLG) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (DEFB1_HUMAN | P60022)
|
|
|
|
|
|
|