![]() |
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 9) Biological Unit 1 (2, 2) Biological Unit 2 (1, 2) Biological Unit 3 (2, 3) Biological Unit 4 (1, 2) Biological Unit 5 (2, 5) Biological Unit 6 (2, 5) Biological Unit 7 (2, 4) |
Asymmetric Unit (9, 9)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1IJU) |
Asymmetric Unit (3, 12)
|
(no "PROSITE Motif" information available for 1IJU) |
Asymmetric Unit (1, 4)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:36 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot Length:68 Alignment length:36 42 52 62 DEFB1_HUMAN 33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68 SCOP domains d1ijua_ A: Beta-defensin, BD SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: A:1-36 UniProt: 21-68 Transcript 1 1iju A 1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 36 10 20 30 Chain B from PDB Type:PROTEIN Length:36 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot Length:68 Alignment length:36 42 52 62 DEFB1_HUMAN 33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68 SCOP domains d1ijub_ B: Beta-defensin, BD SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: B:1-36 UniProt: 21-68 Transcript 1 1iju B 1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 36 10 20 30 Chain C from PDB Type:PROTEIN Length:36 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot Length:68 Alignment length:36 42 52 62 DEFB1_HUMAN 33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68 SCOP domains d1ijuc_ C: Beta-defensin, BD SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: C:1-36 UniProt: 21-68 Transcript 1 1iju C 1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 36 10 20 30 Chain D from PDB Type:PROTEIN Length:36 aligned with DEFB1_HUMAN | P60022 from UniProtKB/Swiss-Prot Length:68 Alignment length:36 42 52 62 DEFB1_HUMAN 33 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68 SCOP domains d1ijud_ D: Beta-defensin, BD SCOP domains CATH domains ------------------------------------ CATH domains Pfam domains ------------------------------------ Pfam domains SAPs(SNPs) -----I---------V------------------S- SAPs(SNPs) PROSITE ------------------------------------ PROSITE Transcript 1 Exon 1.2 PDB: D:1-36 UniProt: 21-68 Transcript 1 1iju D 1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 36 10 20 30
|
Asymmetric Unit |
(no "CATH Domain" information available for 1IJU) |
(no "Pfam Domain" information available for 1IJU) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (DEFB1_HUMAN | P60022)
|
|
|
|
|
|
|