|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2LYL) |
(no "Site" information available for 2LYL) |
(no "SS Bond" information available for 2LYL) |
(no "Cis Peptide Bond" information available for 2LYL) |
(no "SAP(SNP)/Variant" information available for 2LYL) |
(no "PROSITE Motif" information available for 2LYL) |
(no "Exon" information available for 2LYL) |
NMR StructureChain A from PDB Type:PROTEIN Length:66 aligned with Q8VL32_ENTFL | Q8VL32 from UniProtKB/TrEMBL Length:66 Alignment length:66 10 20 30 40 50 60 Q8VL32_ENTFL 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66 SCOP domains d2lyla_ A: Putative transcription regulator CylR2 SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 2lyl A 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:66 aligned with Q8VL32_ENTFL | Q8VL32 from UniProtKB/TrEMBL Length:66 Alignment length:66 10 20 30 40 50 60 Q8VL32_ENTFL 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66 SCOP domains d2lylb_ B: Putative transcription regulator CylR2 SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 2lyl B 67 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 132 76 86 96 106 116 126
|
NMR Structure
|
(no "CATH Domain" information available for 2LYL) |
(no "Pfam Domain" information available for 2LYL) |
NMR Structure(hide GO term definitions) Chain A,B (Q8VL32_ENTFL | Q8VL32)
|
|
|
|
|
|
|