Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  REGULATION OF CYTOLYSIN EXPRESSION BY ENTEROCOCCUS FAECALIS: ROLE OF CYLR2
 
Authors :  A. Razeto, S. Rumpel, C. M. Pillar, M. S. Gilmore, S. Becker, M. Zweckstetter
Date :  12 Dec 03  (Deposition) - 16 Sep 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Dna-Binding Protein, Transcriptional Repressor, Regulation Of Cytolysin Operon, Helix-Turn-Helix (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Rumpel, A. Razeto, C. M. Pillar, V. Vijayan, A. Taylor, K. Giller, M. S. Gilmore, S. Becker, M. Zweckstetter
Structure And Dna-Binding Properties Of The Cytolysin Regulator Cylr2 From Enterococcus Faecalis
Embo J. V. 23 3632 2004
PubMed-ID: 15359276  |  Reference-DOI: 10.1038/SJ.EMBOJ.7600367

(-) Compounds

Molecule 1 - CYLR2
    Atcc19433
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET32A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificENTEROCOCCUS FAECALIS
    Organism Taxid1351
    Other DetailsDSM 20478, NCDO 581, NCIB 775, NCTC 775
    StrainFA2-2(PAM714)

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 10)

Asymmetric/Biological Unit (2, 10)
No.NameCountTypeFull Name
1IOD9Ligand/IonIODIDE ION
2NA1Ligand/IonSODIUM ION

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:32 , LYS A:38 , HOH A:2055BINDING SITE FOR RESIDUE IOD A1067
02AC2SOFTWAREHOH A:2025 , HOH A:2055BINDING SITE FOR RESIDUE IOD A1068
03AC3SOFTWAREGLN A:44 , LYS A:48BINDING SITE FOR RESIDUE IOD A1069
04AC4SOFTWAREHOH A:2014 , HOH A:2087BINDING SITE FOR RESIDUE IOD A1070
05AC5SOFTWAREIOD B:1075BINDING SITE FOR RESIDUE IOD A1072
06AC6SOFTWARESER B:16 , GLN B:17 , HOH B:2023 , HOH B:2027BINDING SITE FOR RESIDUE IOD B1067
07AC7SOFTWARELYS B:14 , ILE B:15 , HOH B:2020BINDING SITE FOR RESIDUE IOD B1068
08AC8SOFTWAREGLN B:44 , HOH B:2029BINDING SITE FOR RESIDUE IOD B1069
09AC9SOFTWAREGLU A:58 , LEU B:57 , GLU B:58BINDING SITE FOR RESIDUE NA B1074
10BC1SOFTWAREIOD A:1072BINDING SITE FOR RESIDUE IOD B1075

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UTX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UTX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UTX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UTX)

(-) Exons   (0, 0)

(no "Exon" information available for 1UTX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:66
 aligned with Q8VL32_ENTFL | Q8VL32 from UniProtKB/TrEMBL  Length:66

    Alignment length:66
                                    10        20        30        40        50        60      
          Q8VL32_ENTFL    1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66
               SCOP domains d1utxa_ A: Putative transcription regulator CylR2                  SCOP domains
               CATH domains 1utxA00 A:1-66 lambda repressor-like DNA-binding domains           CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author eeeehhhhhhhhh..hhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhh...hhhheeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1utx A  1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66
                                    10        20        30        40        50        60      

Chain B from PDB  Type:PROTEIN  Length:66
 aligned with Q8VL32_ENTFL | Q8VL32 from UniProtKB/TrEMBL  Length:66

    Alignment length:66
                                    10        20        30        40        50        60      
          Q8VL32_ENTFL    1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66
               SCOP domains d1utxb_ B: Putative transcription regulator CylR2                  SCOP domains
               CATH domains 1utxB00 B:1-66 lambda repressor-like DNA-binding domains           CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author eeeehhhhhhhhh..hhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhhh...hhhheeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  1utx B  1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66
                                    10        20        30        40        50        60      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1UTX)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q8VL32_ENTFL | Q8VL32)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    IOD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1utx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1utx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8VL32_ENTFL | Q8VL32
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8VL32_ENTFL | Q8VL32
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8VL32_ENTFL | Q8VL322gzu 2lyj 2lyk 2lyl 2lyp 2lyq 2lyr 2lys 2xi8 2xiu 2xj3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UTX)