|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 10)| Asymmetric/Biological Unit (2, 10) |
Sites (10, 10)
Asymmetric Unit (10, 10)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1UTX) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1UTX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1UTX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1UTX) |
Exons (0, 0)| (no "Exon" information available for 1UTX) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:66 aligned with Q8VL32_ENTFL | Q8VL32 from UniProtKB/TrEMBL Length:66 Alignment length:66 10 20 30 40 50 60 Q8VL32_ENTFL 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66 SCOP domains d1utxa_ A: Putative transcription regulator CylR2 SCOP domains CATH domains 1utxA00 A:1-66 lambda repressor-like DNA-binding domains CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 1utx A 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:66 aligned with Q8VL32_ENTFL | Q8VL32 from UniProtKB/TrEMBL Length:66 Alignment length:66 10 20 30 40 50 60 Q8VL32_ENTFL 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66 SCOP domains d1utxb_ B: Putative transcription regulator CylR2 SCOP domains CATH domains 1utxB00 B:1-66 lambda repressor-like DNA-binding domains CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 1utx B 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1UTX) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q8VL32_ENTFL | Q8VL32)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|