|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 3) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 2XIU) |
(no "Cis Peptide Bond" information available for 2XIU) |
(no "SAP(SNP)/Variant" information available for 2XIU) |
(no "PROSITE Motif" information available for 2XIU) |
(no "Exon" information available for 2XIU) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:66 aligned with Q8VL32_ENTFL | Q8VL32 from UniProtKB/TrEMBL Length:66 Alignment length:66 10 20 30 40 50 60 Q8VL32_ENTFL 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE 66 SCOP domains d2xiua_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 2xiu A 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNCPLEDIFQWQPE 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:65 aligned with Q8VL32_ENTFL | Q8VL32 from UniProtKB/TrEMBL Length:66 Alignment length:65 10 20 30 40 50 60 Q8VL32_ENTFL 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQP 65 SCOP domains d2xiub_ B: automated matches SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 2xiu B 1 MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNCPLEDIFQWQP 65 10 20 30 40 50 60
|
Asymmetric/Biological Unit
|
(no "CATH Domain" information available for 2XIU) |
(no "Pfam Domain" information available for 2XIU) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q8VL32_ENTFL | Q8VL32)
|
|
|
|
|
|
|