2L9U - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SPATIAL STRUCTURE OF DIMERIC ERBB3 TRANSMEMBRANE DOMAIN

Authors :   K. S. Mineev, A. S. Arseniev

Date :   24 Feb 11 (Deposition) - 18 May 11 (Release) - 18 May 11 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)
NMR Structure *: A,B  (1x)

Keywords :   Transmenbrane Dimer, Membrane Protein, Erbb, Egfr (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. S. Mineev, N. F. Khabibullina, E. N. Lyukmanova, D. A. Dolgikh, M. P. Kirpichnikov, A. S. Arseniev
Spatial Structure And Dimer-Monomer Equilibrium Of The Erbb Transmembrane Domain In Dpc Micelles
To Be Published
PubMed: search

Molecule 1 - RECEPTOR TYROSINE-PROTEIN KINASE ERBB-3
	Chains	:	A, B
	EC Number	:	2.7.10.1
	Engineered	:	YES
	Expression System	:	CELL-FREE SYNTHESIS
	Expression System Vector	:	PET-22B
	Expression System Vector Type	:	VECTOR
	Fragment	:	UNP RESIDUES 640-670
	Gene	:	ERBB3, HER3
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PROTO-ONCOGENE-LIKE PROTEIN C-ERBB-3, TYROSINE KINASE-TYPE CELL SURFACE RECEPTOR HER3

		1	2
NMR Structure (20x)	:	A	B
NMR Structure * (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2L9U)

(no "Site" information available for 2L9U)

(no "SS Bond" information available for 2L9U)

(no "Cis Peptide Bond" information available for 2L9U)

(no "SAP(SNP)/Variant" information available for 2L9U)

(no "PROSITE Motif" information available for 2L9U)

NMR Structure (2, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000267101	1a	ENSE00001182862	chr12:56473892-56474166	275	ERBB3_HUMAN	1-28	28	0	-	-
1.2	ENST00000267101	2	ENSE00001670328	chr12:56477535-56477686	152	ERBB3_HUMAN	28-78	51	0	-	-
1.3a	ENST00000267101	3a	ENSE00001691214	chr12:56478779-56478965	187	ERBB3_HUMAN	79-141	63	0	-	-
1.4	ENST00000267101	4	ENSE00001607896	chr12:56480315-56480440	126	ERBB3_HUMAN	141-183	43	0	-	-
1.5	ENST00000267101	5	ENSE00001713759	chr12:56481361-56481426	66	ERBB3_HUMAN	183-205	23	0	-	-
1.6	ENST00000267101	6	ENSE00001696674	chr12:56481579-56481697	119	ERBB3_HUMAN	205-244	40	0	-	-
1.7	ENST00000267101	7	ENSE00001784438	chr12:56481805-56481946	142	ERBB3_HUMAN	245-292	48	0	-	-
1.8	ENST00000267101	8	ENSE00001624919	chr12:56482327-56482440	114	ERBB3_HUMAN	292-330	39	0	-	-
1.9a	ENST00000267101	9a	ENSE00000838658	chr12:56482532-56482652	121	ERBB3_HUMAN	330-370	41	0	-	-
1.11	ENST00000267101	11	ENSE00001059664	chr12:56486531-56486604	74	ERBB3_HUMAN	370-395	26	0	-	-
1.12	ENST00000267101	12	ENSE00001143935	chr12:56486770-56486860	91	ERBB3_HUMAN	395-425	31	0	-	-
1.13a	ENST00000267101	13a	ENSE00001143926	chr12:56487129-56487334	206	ERBB3_HUMAN	425-494	70	0	-	-
1.14a	ENST00000267101	14a	ENSE00001143915	chr12:56487548-56487680	133	ERBB3_HUMAN	494-538	45	0	-	-
1.15	ENST00000267101	15	ENSE00001143907	chr12:56487883-56487973	91	ERBB3_HUMAN	538-568	31	0	-	-
1.16	ENST00000267101	16	ENSE00001143899	chr12:56488186-56488340	155	ERBB3_HUMAN	569-620	52	0	-	-
1.17	ENST00000267101	17	ENSE00001059678	chr12:56489041-56489094	54	ERBB3_HUMAN	620-638	19	2	A:637-638 B:637-638	2 2
1.18	ENST00000267101	18	ENSE00001143884	chr12:56489449-56489590	142	ERBB3_HUMAN	638-685	48	2	A:638-676 B:638-676	39 39
1.19	ENST00000267101	19	ENSE00001143876	chr12:56490287-56490406	120	ERBB3_HUMAN	686-725	40	0	-	-
1.20	ENST00000267101	20	ENSE00001143869	chr12:56490532-56490630	99	ERBB3_HUMAN	726-758	33	0	-	-
1.21	ENST00000267101	21	ENSE00001143859	chr12:56490829-56491014	186	ERBB3_HUMAN	759-820	62	0	-	-
1.22	ENST00000267101	22	ENSE00001143850	chr12:56491569-56491724	156	ERBB3_HUMAN	821-872	52	0	-	-
1.23	ENST00000267101	23	ENSE00001143842	chr12:56492284-56492359	76	ERBB3_HUMAN	873-898	26	0	-	-
1.24b	ENST00000267101	24b	ENSE00001143833	chr12:56492543-56492689	147	ERBB3_HUMAN	898-947	50	0	-	-
1.25	ENST00000267101	25	ENSE00001143824	chr12:56493432-56493529	98	ERBB3_HUMAN	947-979	33	0	-	-
1.26	ENST00000267101	26	ENSE00001143816	chr12:56493622-56493813	192	ERBB3_HUMAN	980-1043	64	0	-	-
1.27	ENST00000267101	27	ENSE00001143808	chr12:56493958-56494029	72	ERBB3_HUMAN	1044-1067	24	0	-	-
1.28	ENST00000267101	28	ENSE00001143800	chr12:56494845-56495145	301	ERBB3_HUMAN	1068-1168	101	0	-	-
1.29	ENST00000267101	29	ENSE00001324564	chr12:56495313-56497128	1816	ERBB3_HUMAN	1168-1342	175	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:40
 aligned with ERBB3_HUMAN | P21860 from UniProtKB/Swiss-Prot  Length:1342

    Alignment length:40
                                   646       656       666       676
          ERBB3_HUMAN   637 IGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRA 676
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
           Transcript 1 (1) 1.-------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -Exon 1.18  PDB: A:638-676 [INCOMPLETE]  Transcript 1 (2)
                 2l9u A 637 MGRTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRHHHHHH 676
                                   646       656       666       676

Chain B from PDB  Type:PROTEIN  Length:40
 aligned with ERBB3_HUMAN | P21860 from UniProtKB/Swiss-Prot  Length:1342

    Alignment length:40
                                   646       656       666       676
          ERBB3_HUMAN   637 IGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRA 676
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
           Transcript 1 (1) 1.-------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -Exon 1.18  PDB: B:638-676 [INCOMPLETE]  Transcript 1 (2)
                 2l9u B 637 MGRTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRHHHHHH 676
                                   646       656       666       676

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2L9U)

(no "CATH Domain" information available for 2L9U)

(no "Pfam Domain" information available for 2L9U)

NMR Structure(hide GO term definitions)

Chain A,B (ERBB3_HUMAN | P21860)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0005088	Ras guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0019838	growth factor binding	Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0038132	neuregulin binding	Interacting selectively and non-covalently with a neuregulin, a member of the EGF family of growth factors.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0030296	protein tyrosine kinase activator activity	Increases the activity of a protein tyrosine kinase, an enzyme which phosphorylates a tyrosyl phenolic group on a protein.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004888	transmembrane signaling receptor activity	Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
	GO:0038128	ERBB2 signaling pathway	A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
	GO:0000165	MAPK cascade	An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0014037	Schwann cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of a Schwann cell. Schwann cells are found in the peripheral nervous system, where they insulate neurons and axons, and regulate the environment in which neurons function.
	GO:0021545	cranial nerve development	The process whose specific outcome is the progression of the cranial nerves over time, from its formation to the mature structure. The cranial nerves are composed of twelve pairs of nerves that emanate from the nervous tissue of the hindbrain. These nerves are sensory, motor, or mixed in nature, and provide the motor and general sensory innervation of the head, neck and viscera. They mediate vision, hearing, olfaction and taste and carry the parasympathetic innervation of the autonomic ganglia that control visceral functions.
	GO:0003197	endocardial cushion development	The progression of a cardiac cushion over time, from its initial formation to the mature structure. The endocardial cushion is a specialized region of mesenchymal cells that will give rise to the heart septa and valves.
	GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with withdrawal of a ligand from a cell surface receptor, and ends when the execution phase of apoptosis is triggered.
	GO:0007507	heart development	The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0007162	negative regulation of cell adhesion	Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion.
	GO:0043524	negative regulation of neuron apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
	GO:0051048	negative regulation of secretion	Any process that stops, prevents, or reduces the frequency, rate or extent of the controlled release of a substance from a cell or a tissue.
	GO:0009968	negative regulation of signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
	GO:0051402	neuron apoptotic process	Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0007422	peripheral nervous system development	The process whose specific outcome is the progression of the peripheral nervous system over time, from its formation to the mature structure. The peripheral nervous system is one of the two major divisions of the nervous system. Nerves in the PNS connect the central nervous system (CNS) with sensory organs, other organs, muscles, blood vessels and glands.
	GO:0014065	phosphatidylinositol 3-kinase signaling	A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	Any process that activates or increases the frequency, rate or extent of signaling via the calcineurin-NFAT signaling cascade.
	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0061098	positive regulation of protein tyrosine kinase activity	Any process that increases the rate, frequency, or extent of protein tyrosine kinase activity.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:2000145	regulation of cell motility	Any process that modulates the frequency, rate or extent of cell motility.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016328	lateral plasma membrane	The portion of the plasma membrane at the lateral side of the cell. In epithelial cells, lateral plasma membranes are on the sides of cells which lie at the interface of adjacent cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2l9u)

	Sites
(no "Sites" information available for 2l9u)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2l9u)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2l9u
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ERBB3_HUMAN \| P21860
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.10.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ERBB3_HUMAN \| P21860
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ERBB3_HUMAN \| P21860	:	1m6b 3kex 3lmg 3p11 4leo 4otw 4p59 4riw 4rix 4riy 5cus

(no "Related Entries Specified in the PDB File" available for 2L9U)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (2, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (56, 56)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File