Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CATALYTICALLY INACTIVE KINASE DOMAIN OF THE HUMAN EPIDERMAL GROWTH FACTOR RECEPTOR 3 (HER3)
 
Authors :  N. Jura, Y. Shan, X. Cao, D. E. Shaw, J. Kuriyan
Date :  26 Oct 09  (Deposition) - 22 Dec 09  (Release) - 02 Feb 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A (1x),B (1x)
Keywords :  Kinase Domain, Inactive Kinase, Her3, Erbb3, Atp-Binding, Cell Membrane, Kinase, Membrane, Nucleotide-Binding, Phosphoprotein, Receptor, Transferase, Tyrosine-Protein Kinase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Jura, Y. Shan, X. Cao, D. E. Shaw, J. Kuriyan
Structural Analysis Of The Catalytically Inactive Kinase Domain Of The Human Egf Receptor 3.
Proc. Natl. Acad. Sci. Usa V. 106 21608 2009
PubMed-ID: 20007378  |  Reference-DOI: 10.1073/PNAS.0912101106

(-) Compounds

Molecule 1 - RECEPTOR TYROSINE-PROTEIN KINASE ERBB-3
    ChainsA, B
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System PlasmidPFASTBACHTA
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentUNP RESIDUES 698-1019
    GeneERBB3, ERBB3/HER3, HER3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymC-ERBB3, TYROSINE KINASE-TYPE CELL SURFACE RECEPTOR HER3

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (1x)A (1x)B (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric Unit (2, 4)
No.NameCountTypeFull Name
1ANP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
2MG2Ligand/IonMAGNESIUM ION
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1ANP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
2MG-1Ligand/IonMAGNESIUM ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1ANP1Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
2MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:18 , HOH A:27 , LEU A:696 , GLY A:697 , SER A:698 , GLY A:699 , VAL A:700 , GLY A:702 , VAL A:704 , CYS A:721 , LYS A:723 , GLN A:769 , TYR A:770 , LEU A:771 , ASN A:815 , ARG A:819 , ASN A:820 , LEU A:822 , ASP A:833 , MG A:1001BINDING SITE FOR RESIDUE ANP A 1
2AC2SOFTWAREANP A:1 , HOH A:17 , ASN A:820 , ASP A:833BINDING SITE FOR RESIDUE MG A 1001
3AC3SOFTWAREHOH B:22 , HOH B:25 , HOH B:34 , LEU B:696 , GLY B:697 , SER B:698 , GLY B:699 , VAL B:700 , GLY B:702 , VAL B:704 , CYS B:721 , LYS B:723 , GLN B:769 , TYR B:770 , LEU B:771 , ASN B:815 , ARG B:819 , ASN B:820 , LEU B:822 , ASP B:833 , MG B:1001BINDING SITE FOR RESIDUE ANP B 2
4AC4SOFTWAREANP B:2 , HOH B:21 , HOH B:22 , ASN B:820 , ASP B:833BINDING SITE FOR RESIDUE MG B 1001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3KEX)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Thr A:854 -Pro A:855

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 4)

Asymmetric Unit (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042106S717LERBB3_HUMANPolymorphism35961836A/BS698L
2UniProtVAR_042107I744TERBB3_HUMANPolymorphism55787439A/BI725T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042106S717LERBB3_HUMANPolymorphism35961836A/BS698L
2UniProtVAR_042107I744TERBB3_HUMANPolymorphism55787439A/BI725T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042106S717LERBB3_HUMANPolymorphism35961836A/BS698L
2UniProtVAR_042107I744TERBB3_HUMANPolymorphism55787439A/BI725T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3KEX)

(-) Exons   (8, 16)

Asymmetric Unit (8, 16)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002671011aENSE00001182862chr12:56473892-56474166275ERBB3_HUMAN1-28280--
1.2ENST000002671012ENSE00001670328chr12:56477535-56477686152ERBB3_HUMAN28-78510--
1.3aENST000002671013aENSE00001691214chr12:56478779-56478965187ERBB3_HUMAN79-141630--
1.4ENST000002671014ENSE00001607896chr12:56480315-56480440126ERBB3_HUMAN141-183430--
1.5ENST000002671015ENSE00001713759chr12:56481361-5648142666ERBB3_HUMAN183-205230--
1.6ENST000002671016ENSE00001696674chr12:56481579-56481697119ERBB3_HUMAN205-244400--
1.7ENST000002671017ENSE00001784438chr12:56481805-56481946142ERBB3_HUMAN245-292480--
1.8ENST000002671018ENSE00001624919chr12:56482327-56482440114ERBB3_HUMAN292-330390--
1.9aENST000002671019aENSE00000838658chr12:56482532-56482652121ERBB3_HUMAN330-370410--
1.11ENST0000026710111ENSE00001059664chr12:56486531-5648660474ERBB3_HUMAN370-395260--
1.12ENST0000026710112ENSE00001143935chr12:56486770-5648686091ERBB3_HUMAN395-425310--
1.13aENST0000026710113aENSE00001143926chr12:56487129-56487334206ERBB3_HUMAN425-494700--
1.14aENST0000026710114aENSE00001143915chr12:56487548-56487680133ERBB3_HUMAN494-538450--
1.15ENST0000026710115ENSE00001143907chr12:56487883-5648797391ERBB3_HUMAN538-568310--
1.16ENST0000026710116ENSE00001143899chr12:56488186-56488340155ERBB3_HUMAN569-620520--
1.17ENST0000026710117ENSE00001059678chr12:56489041-5648909454ERBB3_HUMAN620-638190--
1.18ENST0000026710118ENSE00001143884chr12:56489449-56489590142ERBB3_HUMAN638-685480--
1.19ENST0000026710119ENSE00001143876chr12:56490287-56490406120ERBB3_HUMAN686-725402A:679-706
B:679-706
28
28
1.20ENST0000026710120ENSE00001143869chr12:56490532-5649063099ERBB3_HUMAN726-758332A:707-739
B:707-739
33
33
1.21ENST0000026710121ENSE00001143859chr12:56490829-56491014186ERBB3_HUMAN759-820622A:740-801
B:740-801
62
62
1.22ENST0000026710122ENSE00001143850chr12:56491569-56491724156ERBB3_HUMAN821-872522A:802-848
B:802-846
47
45
1.23ENST0000026710123ENSE00001143842chr12:56492284-5649235976ERBB3_HUMAN873-898262A:854-879
B:854-879
26
26
1.24bENST0000026710124bENSE00001143833chr12:56492543-56492689147ERBB3_HUMAN898-947502A:879-928
B:879-928
50
50
1.25ENST0000026710125ENSE00001143824chr12:56493432-5649352998ERBB3_HUMAN947-979332A:928-960
B:928-960
33
33
1.26ENST0000026710126ENSE00001143816chr12:56493622-56493813192ERBB3_HUMAN980-1043642A:961-975
B:961-969 (gaps)
15
9
1.27ENST0000026710127ENSE00001143808chr12:56493958-5649402972ERBB3_HUMAN1044-1067240--
1.28ENST0000026710128ENSE00001143800chr12:56494845-56495145301ERBB3_HUMAN1068-11681010--
1.29ENST0000026710129ENSE00001324564chr12:56495313-564971281816ERBB3_HUMAN1168-13421750--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:292
 aligned with ERBB3_HUMAN | P21860 from UniProtKB/Swiss-Prot  Length:1342

    Alignment length:297
                                   707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       
          ERBB3_HUMAN   698 KVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAPGPEPHG 994
               SCOP domains d3kexa_ A: automated matches                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeeeeee.....eeeeeee........eeeeeeee............hhhhhhhhh........eeeee....eeeeee......hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh...........eee.....eee...hhhhhh........-----......hhhhhhhh..hhhhhhhhhhhhhhhhhh...........hhhhhhhhh..............hhhhhhhh........hhhhhhhhhhhhh.hhhhhh.................. Sec.struct. author
                 SAPs(SNPs) -------------------L--------------------------T---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.19  PDB: A:679-706   Exon 1.20  PDB: A:707-739        Exon 1.21  PDB: A:740-801 UniProt: 759-820                    Exon 1.22  PDB: A:802-848 UniProt: 821-872          Exon 1.23  PDB: A:854-879 ------------------------------------------------Exon 1.25  PDB: A:928-960        Exon 1.26       Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.24b  PDB: A:879-928 UniProt: 898-947       ----------------------------------------------- Transcript 1 (2)
                 3kex A 679 KVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLL-----TPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAPGPEPHG 975
                                   688       698       708       718       728       738       748       758       768       778       788       798       808       818       828       838       848     | 858       868       878       888       898       908       918       928       938       948       958       968       
                                                                                                                                                                                                   848   854                                                                                                                         

Chain B from PDB  Type:PROTEIN  Length:283
 aligned with ERBB3_HUMAN | P21860 from UniProtKB/Swiss-Prot  Length:1342

    Alignment length:291
                                   707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987 
          ERBB3_HUMAN   698 KVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRESGPGIAP 988
               SCOP domains d3kexb_ B: automated matches                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------Pkinase_Tyr-3kexB01 B:690-946                                                                                                                                                                                                                                    ---------------- ------ Pfam domains (1)
           Pfam domains (2) -----------Pkinase_Tyr-3kexB02 B:690-946                                                                                                                                                                                                                                    ---------------- ------ Pfam domains (2)
         Sec.struct. author ...........eeeeeeeee....eeeeeee........eeeeeeee............hhhhhhhhh........eeeee....eeeeee......hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh...........eee.....eee...hhhhhh......-------hhhhh.hhhhhhhh..hhhhhhhhhhhhhhhhhh...........hhhhhhhhh..............hhhhhhhh........hhhhhhhhhhhhh.hhhhhh.....-...... Sec.struct. author
                 SAPs(SNPs) -------------------L--------------------------T---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.19  PDB: B:679-706   Exon 1.20  PDB: B:707-739        Exon 1.21  PDB: B:740-801 UniProt: 759-820                    Exon 1.22  PDB: B:802-846 UniProt: 821-872          Exon 1.23  PDB: B:854-879 ------------------------------------------------Exon 1.25  PDB: B:928-960        Exon 1.26 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.24b  PDB: B:879-928 UniProt: 898-947       ----------------------------------------- Transcript 1 (2)
                 3kex B 679 KVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQ-------TPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRE-GPGIAP 969
                                   688       698       708       718       728       738       748       758       768       778       788       798       808       818       828       838       | -     | 858       868       878       888       898       908       918       928       938       948       958   | | 968 
                                                                                                                                                                                                 846     854                                                                                                         962 |     
                                                                                                                                                                                                                                                                                                                       964     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3KEX)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: PKinase (934)

(-) Gene Ontology  (56, 56)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (ERBB3_HUMAN | P21860)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005088    Ras guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0019838    growth factor binding    Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0038132    neuregulin binding    Interacting selectively and non-covalently with a neuregulin, a member of the EGF family of growth factors.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0046934    phosphatidylinositol-4,5-bisphosphate 3-kinase activity    Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0030296    protein tyrosine kinase activator activity    Increases the activity of a protein tyrosine kinase, an enzyme which phosphorylates a tyrosyl phenolic group on a protein.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004888    transmembrane signaling receptor activity    Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
    GO:0038128    ERBB2 signaling pathway    A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0014037    Schwann cell differentiation    The process in which a relatively unspecialized cell acquires the specialized features of a Schwann cell. Schwann cells are found in the peripheral nervous system, where they insulate neurons and axons, and regulate the environment in which neurons function.
    GO:0021545    cranial nerve development    The process whose specific outcome is the progression of the cranial nerves over time, from its formation to the mature structure. The cranial nerves are composed of twelve pairs of nerves that emanate from the nervous tissue of the hindbrain. These nerves are sensory, motor, or mixed in nature, and provide the motor and general sensory innervation of the head, neck and viscera. They mediate vision, hearing, olfaction and taste and carry the parasympathetic innervation of the autonomic ganglia that control visceral functions.
    GO:0003197    endocardial cushion development    The progression of a cardiac cushion over time, from its initial formation to the mature structure. The endocardial cushion is a specialized region of mesenchymal cells that will give rise to the heart septa and valves.
    GO:0097192    extrinsic apoptotic signaling pathway in absence of ligand    A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with withdrawal of a ligand from a cell surface receptor, and ends when the execution phase of apoptosis is triggered.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0007162    negative regulation of cell adhesion    Any process that stops, prevents, or reduces the frequency, rate or extent of cell adhesion.
    GO:0043524    negative regulation of neuron apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
    GO:0051048    negative regulation of secretion    Any process that stops, prevents, or reduces the frequency, rate or extent of the controlled release of a substance from a cell or a tissue.
    GO:0009968    negative regulation of signal transduction    Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
    GO:0051402    neuron apoptotic process    Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0007422    peripheral nervous system development    The process whose specific outcome is the progression of the peripheral nervous system over time, from its formation to the mature structure. The peripheral nervous system is one of the two major divisions of the nervous system. Nerves in the PNS connect the central nervous system (CNS) with sensory organs, other organs, muscles, blood vessels and glands.
    GO:0014065    phosphatidylinositol 3-kinase signaling    A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
    GO:0046854    phosphatidylinositol phosphorylation    The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
    GO:0048015    phosphatidylinositol-mediated signaling    A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0070886    positive regulation of calcineurin-NFAT signaling cascade    Any process that activates or increases the frequency, rate or extent of signaling via the calcineurin-NFAT signaling cascade.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0061098    positive regulation of protein tyrosine kinase activity    Any process that increases the rate, frequency, or extent of protein tyrosine kinase activity.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:2000145    regulation of cell motility    Any process that modulates the frequency, rate or extent of cell motility.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0014066    regulation of phosphatidylinositol 3-kinase signaling    Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0016324    apical plasma membrane    The region of the plasma membrane located at the apical end of the cell.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0016328    lateral plasma membrane    The portion of the plasma membrane at the lateral side of the cell. In epithelial cells, lateral plasma membranes are on the sides of cells which lie at the interface of adjacent cells.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ANP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:854 - Pro A:855   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3kex
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ERBB3_HUMAN | P21860
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ERBB3_HUMAN | P21860
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ERBB3_HUMAN | P218601m6b 2l9u 3lmg 3p11 4leo 4otw 4p59 4riw 4rix 4riy 5cus

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3KEX)