Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF THE N-TERMINAL PAS DOMAIN OF HERG
 
Authors :  N. Gayen, Q. Li, A. S. Chen, Q. Huang, M. Raida, C. Kang
Date :  13 Oct 10  (Deposition) - 22 Dec 10  (Release) - 22 Dec 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Herg, Potassium Channel, Pas Domain, Eag Domain, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Q. Li, S. Gayen, A. S. Chen, Q. Huang, M. Raida, C. Kang
Nmr Solution Structure Of The N-Terminal Domain Of Herg And Its Interaction With The S4-S5 Linker.
Biochem. Biophys. Res. Commun. V. 403 126 2010
PubMed-ID: 21055387  |  Reference-DOI: 10.1016/J.BBRC.2010.10.132

(-) Compounds

Molecule 1 - POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY H MEMBER 2
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PET16B
    Expression System Vector Type: VECTOR
    Fragment: UNP RESIDUES 1-135
    Gene: KCNH2, ERG, ERG1, HERG
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: EAG HOMOLOG, ETHER-A-GO-GO-RELATED GENE POTASSIUM CHANNEL 1, ERG-1, EAG-RELATED PROTEIN 1, ETHER-A-GO-GO-RELATED PROTEIN 1, H-ERG, HERG-1, HERG1, VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT KV11.1

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2L4R)

(-) Sites  (0, 0)

(no "Site" information available for 2L4R)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2L4R)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2L4R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (48, 48)

NMR Structure (48, 48)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_074765D16AKCNH2_HUMANUnclassified (LQT2)199472825AD16A
02UniProtVAR_074766R20GKCNH2_HUMANUnclassified (LQT2)199473486AR20G
03UniProtVAR_068249S26IKCNH2_HUMANDisease (LQT2)199472827AS26I
04UniProtVAR_008907F29LKCNH2_HUMANDisease (LQT2)199472830AF29L
05UniProtVAR_074767I30TKCNH2_HUMANUnclassified (LQT2)199472832AI30T
06UniProtVAR_068250I31SKCNH2_HUMANDisease (LQT2)199472833AI31S
07UniProtVAR_074768A32TKCNH2_HUMANUnclassified (LQT2)199472834AA32T
08UniProtVAR_008908N33TKCNH2_HUMANDisease (LQT2)199473487AN33T
09UniProtVAR_074769V41FKCNH2_HUMANUnclassified (LQT2)199472835AV41F
10UniProtVAR_074770Y43CKCNH2_HUMANUnclassified (LQT2)199472836AY43C
11UniProtVAR_074771N45YKCNH2_HUMANUnclassified (LQT2)199472839AN45Y
12UniProtVAR_009909G47VKCNH2_HUMANDisease (LQT2)199473490AG47V
13UniProtVAR_074772C49YKCNH2_HUMANUnclassified (LQT2)199472840AC49Y
14UniProtVAR_074773G53DKCNH2_HUMANUnclassified (LQT2)199473491AG53D
15UniProtVAR_008909G53RKCNH2_HUMANDisease (LQT2)199472842AG53R
16UniProtVAR_074774Y54HKCNH2_HUMANUnclassified (LQT2)199472843AY54H
17UniProtVAR_068251S55LKCNH2_HUMANDisease (LQT2)199472844AS55L
18UniProtVAR_008910R56QKCNH2_HUMANDisease (LQT2)199472845AR56Q
19UniProtVAR_074775A57PKCNH2_HUMANUnclassified (LQT2)199472846AA57P
20UniProtVAR_074776E58AKCNH2_HUMANUnclassified (LQT2)199472847AE58A
21UniProtVAR_074777E58DKCNH2_HUMANUnclassified (LQT2)199473492AE58D
22UniProtVAR_074778E58GKCNH2_HUMANUnclassified (LQT2)199472847AE58G
23UniProtVAR_074779C64WKCNH2_HUMANUnclassified (LQT2)199473414AC64W
24UniProtVAR_077953C64YKCNH2_HUMANDisease (LQT2)199473415AC64Y
25UniProtVAR_014371T65PKCNH2_HUMANDisease (LQT2)28933095AT65P
26UniProtVAR_008911C66GKCNH2_HUMANDisease (LQT2)199473416AC66G
27UniProtVAR_074780F68LKCNH2_HUMANUnclassified (LQT2)199473417AF68L
28UniProtVAR_074781H70NKCNH2_HUMANUnclassified (LQT2)199473418AH70N
29UniProtVAR_008912H70RKCNH2_HUMANDisease (LQT2)199473419AH70R
30UniProtVAR_074782G71RKCNH2_HUMANUnclassified (LQT2)199473420AG71R
31UniProtVAR_074784P72LKCNH2_HUMANUnclassified (LQT2)199473421AP72L
32UniProtVAR_009910P72QKCNH2_HUMANUnclassified (LQT2)199473421AP72Q
33UniProtVAR_074785T74MKCNH2_HUMANDisease (LQT2)199473422AT74M
34UniProtVAR_074786T74PKCNH2_HUMANUnclassified (LQT2)199473666AT74P
35UniProtVAR_074787T74RKCNH2_HUMANUnclassified (LQT2)199473422AT74R
36UniProtVAR_008913A78PKCNH2_HUMANDisease (LQT2)199472848AA78P
37UniProtVAR_068252A85VKCNH2_HUMANDisease (LQT2)199473494AA85V
38UniProtVAR_074788L86PKCNH2_HUMANUnclassified (LQT2)199472851AL86P
39UniProtVAR_008914L86RKCNH2_HUMANDisease (LQT2)199472851AL86R
40UniProtVAR_074789V94GKCNH2_HUMANUnclassified (LQT2)199472852AV94G
41UniProtVAR_036669R100GKCNH2_HUMANDisease (LQT2)121912515AR100G
42UniProtVAR_068253R100QKCNH2_HUMANDisease (LQT2)199472855AR100Q
43UniProtVAR_074790R100WKCNH2_HUMANUnclassified (LQT2)121912515AR100W
44UniProtVAR_074791D102AKCNH2_HUMANUnclassified (LQT2)199472857AD102A
45UniProtVAR_074792F106YKCNH2_HUMANUnclassified (LQT2)199472858AF106Y
46UniProtVAR_074793C108RKCNH2_HUMANUnclassified (LQT2)199472859AC108R
47UniProtVAR_074794P114SKCNH2_HUMANUnclassified (LQT2)199472861AP114S
48UniProtVAR_074795F125CKCNH2_HUMANUnclassified (LQT2)199473499AF125C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
NMR Structure * (48, 48)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_074765D16AKCNH2_HUMANUnclassified (LQT2)199472825AD16A
02UniProtVAR_074766R20GKCNH2_HUMANUnclassified (LQT2)199473486AR20G
03UniProtVAR_068249S26IKCNH2_HUMANDisease (LQT2)199472827AS26I
04UniProtVAR_008907F29LKCNH2_HUMANDisease (LQT2)199472830AF29L
05UniProtVAR_074767I30TKCNH2_HUMANUnclassified (LQT2)199472832AI30T
06UniProtVAR_068250I31SKCNH2_HUMANDisease (LQT2)199472833AI31S
07UniProtVAR_074768A32TKCNH2_HUMANUnclassified (LQT2)199472834AA32T
08UniProtVAR_008908N33TKCNH2_HUMANDisease (LQT2)199473487AN33T
09UniProtVAR_074769V41FKCNH2_HUMANUnclassified (LQT2)199472835AV41F
10UniProtVAR_074770Y43CKCNH2_HUMANUnclassified (LQT2)199472836AY43C
11UniProtVAR_074771N45YKCNH2_HUMANUnclassified (LQT2)199472839AN45Y
12UniProtVAR_009909G47VKCNH2_HUMANDisease (LQT2)199473490AG47V
13UniProtVAR_074772C49YKCNH2_HUMANUnclassified (LQT2)199472840AC49Y
14UniProtVAR_074773G53DKCNH2_HUMANUnclassified (LQT2)199473491AG53D
15UniProtVAR_008909G53RKCNH2_HUMANDisease (LQT2)199472842AG53R
16UniProtVAR_074774Y54HKCNH2_HUMANUnclassified (LQT2)199472843AY54H
17UniProtVAR_068251S55LKCNH2_HUMANDisease (LQT2)199472844AS55L
18UniProtVAR_008910R56QKCNH2_HUMANDisease (LQT2)199472845AR56Q
19UniProtVAR_074775A57PKCNH2_HUMANUnclassified (LQT2)199472846AA57P
20UniProtVAR_074776E58AKCNH2_HUMANUnclassified (LQT2)199472847AE58A
21UniProtVAR_074777E58DKCNH2_HUMANUnclassified (LQT2)199473492AE58D
22UniProtVAR_074778E58GKCNH2_HUMANUnclassified (LQT2)199472847AE58G
23UniProtVAR_074779C64WKCNH2_HUMANUnclassified (LQT2)199473414AC64W
24UniProtVAR_077953C64YKCNH2_HUMANDisease (LQT2)199473415AC64Y
25UniProtVAR_014371T65PKCNH2_HUMANDisease (LQT2)28933095AT65P
26UniProtVAR_008911C66GKCNH2_HUMANDisease (LQT2)199473416AC66G
27UniProtVAR_074780F68LKCNH2_HUMANUnclassified (LQT2)199473417AF68L
28UniProtVAR_074781H70NKCNH2_HUMANUnclassified (LQT2)199473418AH70N
29UniProtVAR_008912H70RKCNH2_HUMANDisease (LQT2)199473419AH70R
30UniProtVAR_074782G71RKCNH2_HUMANUnclassified (LQT2)199473420AG71R
31UniProtVAR_074784P72LKCNH2_HUMANUnclassified (LQT2)199473421AP72L
32UniProtVAR_009910P72QKCNH2_HUMANUnclassified (LQT2)199473421AP72Q
33UniProtVAR_074785T74MKCNH2_HUMANDisease (LQT2)199473422AT74M
34UniProtVAR_074786T74PKCNH2_HUMANUnclassified (LQT2)199473666AT74P
35UniProtVAR_074787T74RKCNH2_HUMANUnclassified (LQT2)199473422AT74R
36UniProtVAR_008913A78PKCNH2_HUMANDisease (LQT2)199472848AA78P
37UniProtVAR_068252A85VKCNH2_HUMANDisease (LQT2)199473494AA85V
38UniProtVAR_074788L86PKCNH2_HUMANUnclassified (LQT2)199472851AL86P
39UniProtVAR_008914L86RKCNH2_HUMANDisease (LQT2)199472851AL86R
40UniProtVAR_074789V94GKCNH2_HUMANUnclassified (LQT2)199472852AV94G
41UniProtVAR_036669R100GKCNH2_HUMANDisease (LQT2)121912515AR100G
42UniProtVAR_068253R100QKCNH2_HUMANDisease (LQT2)199472855AR100Q
43UniProtVAR_074790R100WKCNH2_HUMANUnclassified (LQT2)121912515AR100W
44UniProtVAR_074791D102AKCNH2_HUMANUnclassified (LQT2)199472857AD102A
45UniProtVAR_074792F106YKCNH2_HUMANUnclassified (LQT2)199472858AF106Y
46UniProtVAR_074793C108RKCNH2_HUMANUnclassified (LQT2)199472859AC108R
47UniProtVAR_074794P114SKCNH2_HUMANUnclassified (LQT2)199472861AP114S
48UniProtVAR_074795F125CKCNH2_HUMANUnclassified (LQT2)199473499AF125C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PASPS50112 PAS repeat profile.KCNH2_HUMAN41-70  1A:41-70
2PACPS50113 PAC domain profile.KCNH2_HUMAN92-144  1A:92-135
NMR Structure * (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PASPS50112 PAS repeat profile.KCNH2_HUMAN41-70  1A:41-70
2PACPS50113 PAC domain profile.KCNH2_HUMAN92-144  1A:92-135

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002621861aENSE00001475694chr7:150675403-150674926478KCNH2_HUMAN1-26261A:1-2626
1.2ENST000002621862ENSE00001141390chr7:150672029-150671799231KCNH2_HUMAN26-103781A:26-10378
1.3ENST000002621863ENSE00001141475chr7:150656824-150656660165KCNH2_HUMAN103-158561A:103-13533
1.4ENST000002621864ENSE00000729926chr7:150655590-150655147444KCNH2_HUMAN158-3061490--
1.5ENST000002621865ENSE00000909768chr7:150654590-150654379212KCNH2_HUMAN306-376710--
1.7ENST000002621867ENSE00000909766chr7:150649941-150649513429KCNH2_HUMAN377-5191430--
1.8aENST000002621868aENSE00000909764chr7:150648923-150648536388KCNH2_HUMAN520-6491300--
1.8cENST000002621868cENSE00001677788chr7:150648208-150648009200KCNH2_HUMAN649-715670--
1.9aENST000002621869aENSE00001801009chr7:150647508-150647256253KCNH2_HUMAN716-800850--
1.10ENST0000026218610ENSE00000978099chr7:150646137-150645944194KCNH2_HUMAN800-864650--
1.11ENST0000026218611ENSE00000872389chr7:150645631-150645532100KCNH2_HUMAN865-898340--
1.12ENST0000026218612ENSE00001141381chr7:150644966-150644694273KCNH2_HUMAN898-989920--
1.13ENST0000026218613ENSE00001141375chr7:150644602-150644416187KCNH2_HUMAN989-1051630--
1.14ENST0000026218614ENSE00001141370chr7:150644142-150643965178KCNH2_HUMAN1051-1110600--
1.15ENST0000026218615ENSE00000872388chr7:150642602-150642049554KCNH2_HUMAN1111-1159490--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:135
 aligned with KCNH2_HUMAN | Q12809 from UniProtKB/Swiss-Prot  Length:1159

    Alignment length:135
                                    10        20        30        40        50        60        70        80        90       100       110       120       130     
          KCNH2_HUMAN     1 MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK 135
               SCOP domains d2l4ra_ A: automated matches                                                                                                            SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhh..eeeee.........eehhhhhhhhh.hhhhhh.....hhhhh....hhhhhhhhhhhhhhh..eeeeeeee.....eeeeeeeeeee........eeeeeeeeee.. Sec.struct. author
             SAPs(SNPs) (1) ---------------A---G-----I--LTSTT-------F-C-Y-V-Y---DHLQPA-----WPG-L-NRL-M---P------VP-------G-----G-A---Y-R-----S----------C---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------R----D-----Y-----R-Q-P-----------R-------------Q----------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------------------------------------G---------------R-------------------------W----------------------------------- SAPs(SNPs) (3)
                    PROSITE ----------------------------------------PAS  PDB: A:41-70             ---------------------PAC  PDB: A:92-135 UniProt: 92-144           PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:1-26    ----------------------------------------------------------------------------Exon 1.3  PDB: A:103-135          Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.2  PDB: A:26-103 UniProt: 26-103                                       -------------------------------- Transcript 1 (2)
                 2l4r A   1 MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK 135
                                    10        20        30        40        50        60        70        80        90       100       110       120       130     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2L4R)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2L4R)

(-) Gene Ontology  (49, 49)

NMR Structure(hide GO term definitions)
Chain A   (KCNH2_HUMAN | Q12809)
molecular function
    GO:0055131    C3HC4-type RING finger domain binding    Interacting selectively and non-covalently with a C3HC4-type zinc finger domain of a protein. The C3HC4-type zinc finger is a variant of RING finger, is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C, where X is any amino acid. Many proteins containing a C3HC4-type RING finger play a key role in the ubiquitination pathway.
    GO:0005251    delayed rectifier potassium channel activity    Enables the transmembrane transfer of a potassium ion by a delayed rectifying voltage-gated channel. A delayed rectifying current-voltage relation is one where channel activation kinetics are time-dependent, and inactivation is slow.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005242    inward rectifier potassium channel activity    Enables the transmembrane transfer of a potassium ion by an inwardly-rectifying voltage-gated channel. An inwardly rectifying current-voltage relation is one where at any given driving force the inward flow of K+ ions exceeds the outward flow for the opposite driving force. The inward-rectification is due to a voltage-dependent block of the channel pore by a specific ligand or ligands, and as a result the macroscopic conductance depends on the difference between membrane voltage and the K+ equilibrium potential rather than on membrane voltage itself.
    GO:0005216    ion channel activity    Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
    GO:0000155    phosphorelay sensor kinase activity    Catalysis of the phosphorylation of a histidine residue in response to detection of an extracellular signal such as a chemical ligand or change in environment, to initiate a change in cell state or activity. The two-component sensor is a histidine kinase that autophosphorylates a histidine residue in its active site. The phosphate is then transferred to an aspartate residue in a downstream response regulator, to trigger a response.
    GO:0005267    potassium channel activity    Enables the facilitated diffusion of a potassium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0097110    scaffold protein binding    Interacting selectively and non-covalently with a scaffold protein. Scaffold proteins are crucial regulators of many key signaling pathways. Although not strictly defined in function, they are known to interact and/or bind with multiple members of a signaling pathway, tethering them into complexes.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0005244    voltage-gated ion channel activity    Enables the transmembrane transfer of an ion by a voltage-gated channel. An ion is an atom or group of atoms carrying an electric charge by virtue of having gained or lost one or more electrons. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
    GO:0005249    voltage-gated potassium channel activity    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
    GO:0086008    voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel through the plasma membrane of a cardiac muscle cell contributing to the repolarization phase of an action potential. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
    GO:1902282    voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel through the plasma membrane of a ventricular cardiomyocyte contributing to the repolarization phase of an action potential. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
biological process
    GO:0061337    cardiac conduction    Transfer of an organized electrical impulse across the heart to coordinate the contraction of cardiac muscles. The process begins with generation of an action potential (in the sinoatrial node (SA) in humans) and ends with a change in the rate, frequency, or extent of the contraction of the heart muscles.
    GO:0060048    cardiac muscle contraction    Muscle contraction of cardiac muscle tissue.
    GO:0035690    cellular response to drug    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0086010    membrane depolarization during action potential    The process in which membrane potential changes in the depolarizing direction from the negative resting potential towards the positive membrane potential that will be the peak of the action potential.
    GO:0086011    membrane repolarization during action potential    The process in which ions are transported across a membrane such that the membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
    GO:0086013    membrane repolarization during cardiac muscle cell action potential    The process in which ions are transported across a membrane such that the cardiac muscle cell plasma membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
    GO:0098915    membrane repolarization during ventricular cardiac muscle cell action potential    The process in which ions are transported across a membrane such that the ventricular cardiomyocyte membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
    GO:1902303    negative regulation of potassium ion export    Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion export.
    GO:1901380    negative regulation of potassium ion transmembrane transport    Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transport.
    GO:0000160    phosphorelay signal transduction system    A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
    GO:1901381    positive regulation of potassium ion transmembrane transport    Any process that activates or increases the frequency, rate or extent of potassium ion transmembrane transport.
    GO:0071435    potassium ion export    The directed movement of potassium ions out of a cell or organelle.
    GO:0097623    potassium ion export across plasma membrane    The directed movement of potassium ions from inside of a cell, across the plasma membrane and into the extracellular region.
    GO:0055075    potassium ion homeostasis    Any process involved in the maintenance of an internal steady state of potassium ions within an organism or cell.
    GO:0071805    potassium ion transmembrane transport    A process in which a potassium ion is transported from one side of a membrane to the other.
    GO:0006813    potassium ion transport    The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0086091    regulation of heart rate by cardiac conduction    A cardiac conduction process that modulates the frequency or rate of heart contraction.
    GO:0003064    regulation of heart rate by hormone    The process in which the hormones modulates the rate of heart muscle contraction. A hormone is one of a group of substances formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells, in the same organism, upon which they have a specific regulatory action.
    GO:0034765    regulation of ion transmembrane transport    Any process that modulates the frequency, rate or extent of the directed movement of ions from one side of a membrane to the other.
    GO:0042391    regulation of membrane potential    Any process that modulates the establishment or extent of a membrane potential, the electric potential existing across any membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
    GO:0060306    regulation of membrane repolarization    Any process that modulates the establishment or extent of a membrane potential in the polarizing direction towards the resting potential, usually from positive to negative.
    GO:1901379    regulation of potassium ion transmembrane transport    Any process that modulates the frequency, rate or extent of potassium ion transmembrane transport.
    GO:0060307    regulation of ventricular cardiac muscle cell membrane repolarization    Any process that modulates the establishment or extent of a membrane potential in the polarizing direction towards the resting potential in a ventricular cardiomyocyte.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
    GO:0055085    transmembrane transport    The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0086005    ventricular cardiac muscle cell action potential    An action potential that occurs in a ventricular cardiac muscle cell.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2l4r)
 
  Sites
(no "Sites" information available for 2l4r)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2l4r)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2l4r
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KCNH2_HUMAN | Q12809
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  613688
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KCNH2_HUMAN | Q12809
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KCNH2_HUMAN | Q12809: 1byw 1ujl 2l0w 2l1m 2le7 2n7g 4hp9 4hqa 5va1 5va2 5va3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2L4R)