Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE HERG K+ CHANNEL S5-P EXTRACELLULAR LINKER
 
Authors :  A. M. Torres, P. S. Bansal, M. Sunde, C. E. Clarke, J. A. Bursill, D. J. Smith, A. Bauskin, S. N. Breit, T. J. Campbell, P. F. Alewood, P. W. Kuchel, J. I. Vandenberg
Date :  05 Aug 03  (Deposition) - 04 Nov 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Two Helices, Amphiphatic Helix, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. M. Torres, P. S. Bansal, M. Sunde, C. E. Clarke, J. A. Bursill, D. J. Smith, A. Bauskin, S. N. Breit, T. J. Campbell, P. F. Alewood, P. W. Kuchel, J. I. Vandenberg
Structure Of The Herg K+ Channel S5P Extracellular Linker: Role Of An Amphipathic Alpha-Helix In C-Type Inactivation.
J. Biol. Chem. V. 278 42136 2003
PubMed-ID: 13680209  |  Reference-DOI: 10.1074/JBC.M212824200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY H MEMBER 2
    ChainsA
    EngineeredYES
    FragmentRESIDUES 1-42
    Other DetailsTHE PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN HOMO SAPIENS (HUMAN).
    SynonymHERG K+ CHANNEL S5-P EXTRACELLULAR LINKER, ETHER- A-GO-GO RELATED GENE POTASSIUM CHANNEL 1, H-ERG, ERG1, ETHER-A-GO-GO RELATED PROTEIN 1, EAG RELATED PROTEIN 1, EAG HOMOLOG
    SyntheticYES

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UJL)

(-) Sites  (0, 0)

(no "Site" information available for 1UJL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UJL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UJL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (32, 32)

NMR Structure (32, 32)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_068265I571LKCNH2_HUMANDisease (LQT2)199472928AI2L
02UniProtVAR_074832I571VKCNH2_HUMANUnclassified (LQT2)199472928AI2V
03UniProtVAR_008923G572CKCNH2_HUMANDisease (LQT2)9333649AG3C
04UniProtVAR_074833G572DKCNH2_HUMANDisease (LQT2)199473423AG3D
05UniProtVAR_008922G572RKCNH2_HUMANDisease (LQT2)9333649AG3R
06UniProtVAR_068266G572SKCNH2_HUMANDisease (LQT2)9333649AG3S
07UniProtVAR_074834G572VKCNH2_HUMANUnclassified (LQT2)199473423AG3V
08UniProtVAR_008581R582CKCNH2_HUMANDisease (LQT2)121912508AR13C
09UniProtVAR_074835R582LKCNH2_HUMANUnclassified (LQT2)199473426AR13L
10UniProtVAR_074836G584RKCNH2_HUMANUnclassified (LQT2)199473428AG15R
11UniProtVAR_008924G584SKCNH2_HUMANDisease (LQT2)199473428AG15S
12UniProtVAR_009914W585CKCNH2_HUMANUnclassified (LQT2)199473430AW16C
13UniProtVAR_008925N588DKCNH2_HUMANDisease (LQT2)199473431AN19D
14UniProtVAR_023840N588KKCNH2_HUMANDisease (SQT1)104894021AN19K
15UniProtVAR_074837I593KKCNH2_HUMANUnclassified (LQT2)28928904AI24K
16UniProtVAR_008582I593RKCNH2_HUMANDisease (LQT2)28928904AI24R
17UniProtVAR_009915I593TKCNH2_HUMANDisease (LQT2)28928904AI24T
18UniProtVAR_074838G594DKCNH2_HUMANUnclassified (LQT2)199472931AG25D
19UniProtVAR_074839P596HKCNH2_HUMANUnclassified (LQT2)199472933AP27H
20UniProtVAR_074840P596LKCNH2_HUMANUnclassified (LQT2)199472933AP27L
21UniProtVAR_068267P596RKCNH2_HUMANDisease (LQT2)199472933AP27R
22UniProtVAR_074841Y597CKCNH2_HUMANUnclassified (LQT2)199472934AY28C
23UniProtVAR_074842S599RKCNH2_HUMANUnclassified (LQT2)199472935AS30R
24UniProtVAR_074843G601CKCNH2_HUMANUnclassified (LQT2)199472936AG32C
25UniProtVAR_008926G601SKCNH2_HUMANDisease (LQT2)199472936AG32S
26UniProtVAR_008927G604SKCNH2_HUMANDisease (LQT2)199473522AG35S
27UniProtVAR_074844P605LKCNH2_HUMANUnclassified (LQT2)199472938AP36L
28UniProtVAR_074845P605SKCNH2_HUMANUnclassified (LQT2)199472939AP36S
29UniProtVAR_074846D609GKCNH2_HUMANUnclassified (LQT2)199472940AD40G
30UniProtVAR_074847D609HKCNH2_HUMANUnclassified (LQT2)199472941AD40H
31UniProtVAR_009916D609NKCNH2_HUMANDisease (LQT2)199472941AD40N
32UniProtVAR_008928Y611HKCNH2_HUMANDisease (LQT2)199472942AY42H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UJL)

(-) Exons   (1, 1)

NMR Structure (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002621861aENSE00001475694chr7:150675403-150674926478KCNH2_HUMAN1-26260--
1.2ENST000002621862ENSE00001141390chr7:150672029-150671799231KCNH2_HUMAN26-103780--
1.3ENST000002621863ENSE00001141475chr7:150656824-150656660165KCNH2_HUMAN103-158560--
1.4ENST000002621864ENSE00000729926chr7:150655590-150655147444KCNH2_HUMAN158-3061490--
1.5ENST000002621865ENSE00000909768chr7:150654590-150654379212KCNH2_HUMAN306-376710--
1.7ENST000002621867ENSE00000909766chr7:150649941-150649513429KCNH2_HUMAN377-5191430--
1.8aENST000002621868aENSE00000909764chr7:150648923-150648536388KCNH2_HUMAN520-6491301A:1-4242
1.8cENST000002621868cENSE00001677788chr7:150648208-150648009200KCNH2_HUMAN649-715670--
1.9aENST000002621869aENSE00001801009chr7:150647508-150647256253KCNH2_HUMAN716-800850--
1.10ENST0000026218610ENSE00000978099chr7:150646137-150645944194KCNH2_HUMAN800-864650--
1.11ENST0000026218611ENSE00000872389chr7:150645631-150645532100KCNH2_HUMAN865-898340--
1.12ENST0000026218612ENSE00001141381chr7:150644966-150644694273KCNH2_HUMAN898-989920--
1.13ENST0000026218613ENSE00001141375chr7:150644602-150644416187KCNH2_HUMAN989-1051630--
1.14ENST0000026218614ENSE00001141370chr7:150644142-150643965178KCNH2_HUMAN1051-1110600--
1.15ENST0000026218615ENSE00000872388chr7:150642602-150642049554KCNH2_HUMAN1111-1159490--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:42
 aligned with KCNH2_HUMAN | Q12809 from UniProtKB/Swiss-Prot  Length:1159

    Alignment length:42
                                   579       589       599       609  
          KCNH2_HUMAN   570 AIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKY 611
               SCOP domains d1ujla_ A:                                 SCOP domains
               CATH domains ------------------------------------------ CATH domains
               Pfam domains Ion_trans-1ujlA01 A:1-42                   Pfam domains
         Sec.struct. author ...............hhhhhhhhhh.........hhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -LC---------C-RC--D----KD-HC-R-C--SL---G-H SAPs(SNPs) (1)
             SAPs(SNPs) (2) -VD---------L-S---K----R--L----S---S---H-- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --R--------------------T--R------------N-- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --S--------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) --V--------------------------------------- SAPs(SNPs) (5)
                    PROSITE ------------------------------------------ PROSITE
               Transcript 1 Exon 1.8a  PDB: A:1-42 UniProt: 520-649    Transcript 1
                 1ujl A   1 AIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKY  42
                                    10        20        30        40  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1UJL)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (49, 49)

NMR Structure(hide GO term definitions)
Chain A   (KCNH2_HUMAN | Q12809)
molecular function
    GO:0055131    C3HC4-type RING finger domain binding    Interacting selectively and non-covalently with a C3HC4-type zinc finger domain of a protein. The C3HC4-type zinc finger is a variant of RING finger, is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C, where X is any amino acid. Many proteins containing a C3HC4-type RING finger play a key role in the ubiquitination pathway.
    GO:0005251    delayed rectifier potassium channel activity    Enables the transmembrane transfer of a potassium ion by a delayed rectifying voltage-gated channel. A delayed rectifying current-voltage relation is one where channel activation kinetics are time-dependent, and inactivation is slow.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005242    inward rectifier potassium channel activity    Enables the transmembrane transfer of a potassium ion by an inwardly-rectifying voltage-gated channel. An inwardly rectifying current-voltage relation is one where at any given driving force the inward flow of K+ ions exceeds the outward flow for the opposite driving force. The inward-rectification is due to a voltage-dependent block of the channel pore by a specific ligand or ligands, and as a result the macroscopic conductance depends on the difference between membrane voltage and the K+ equilibrium potential rather than on membrane voltage itself.
    GO:0005216    ion channel activity    Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
    GO:0000155    phosphorelay sensor kinase activity    Catalysis of the phosphorylation of a histidine residue in response to detection of an extracellular signal such as a chemical ligand or change in environment, to initiate a change in cell state or activity. The two-component sensor is a histidine kinase that autophosphorylates a histidine residue in its active site. The phosphate is then transferred to an aspartate residue in a downstream response regulator, to trigger a response.
    GO:0005267    potassium channel activity    Enables the facilitated diffusion of a potassium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0097110    scaffold protein binding    Interacting selectively and non-covalently with a scaffold protein. Scaffold proteins are crucial regulators of many key signaling pathways. Although not strictly defined in function, they are known to interact and/or bind with multiple members of a signaling pathway, tethering them into complexes.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0005244    voltage-gated ion channel activity    Enables the transmembrane transfer of an ion by a voltage-gated channel. An ion is an atom or group of atoms carrying an electric charge by virtue of having gained or lost one or more electrons. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
    GO:0005249    voltage-gated potassium channel activity    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
    GO:0086008    voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel through the plasma membrane of a cardiac muscle cell contributing to the repolarization phase of an action potential. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
    GO:1902282    voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel through the plasma membrane of a ventricular cardiomyocyte contributing to the repolarization phase of an action potential. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
biological process
    GO:0061337    cardiac conduction    Transfer of an organized electrical impulse across the heart to coordinate the contraction of cardiac muscles. The process begins with generation of an action potential (in the sinoatrial node (SA) in humans) and ends with a change in the rate, frequency, or extent of the contraction of the heart muscles.
    GO:0060048    cardiac muscle contraction    Muscle contraction of cardiac muscle tissue.
    GO:0035690    cellular response to drug    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0086010    membrane depolarization during action potential    The process in which membrane potential changes in the depolarizing direction from the negative resting potential towards the positive membrane potential that will be the peak of the action potential.
    GO:0086011    membrane repolarization during action potential    The process in which ions are transported across a membrane such that the membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
    GO:0086013    membrane repolarization during cardiac muscle cell action potential    The process in which ions are transported across a membrane such that the cardiac muscle cell plasma membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
    GO:0098915    membrane repolarization during ventricular cardiac muscle cell action potential    The process in which ions are transported across a membrane such that the ventricular cardiomyocyte membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
    GO:1902303    negative regulation of potassium ion export    Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion export.
    GO:1901380    negative regulation of potassium ion transmembrane transport    Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transport.
    GO:0000160    phosphorelay signal transduction system    A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
    GO:1901381    positive regulation of potassium ion transmembrane transport    Any process that activates or increases the frequency, rate or extent of potassium ion transmembrane transport.
    GO:0071435    potassium ion export    The directed movement of potassium ions out of a cell or organelle.
    GO:0097623    potassium ion export across plasma membrane    The directed movement of potassium ions from inside of a cell, across the plasma membrane and into the extracellular region.
    GO:0055075    potassium ion homeostasis    Any process involved in the maintenance of an internal steady state of potassium ions within an organism or cell.
    GO:0071805    potassium ion transmembrane transport    A process in which a potassium ion is transported from one side of a membrane to the other.
    GO:0006813    potassium ion transport    The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0086091    regulation of heart rate by cardiac conduction    A cardiac conduction process that modulates the frequency or rate of heart contraction.
    GO:0003064    regulation of heart rate by hormone    The process in which the hormones modulates the rate of heart muscle contraction. A hormone is one of a group of substances formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells, in the same organism, upon which they have a specific regulatory action.
    GO:0034765    regulation of ion transmembrane transport    Any process that modulates the frequency, rate or extent of the directed movement of ions from one side of a membrane to the other.
    GO:0042391    regulation of membrane potential    Any process that modulates the establishment or extent of a membrane potential, the electric potential existing across any membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
    GO:0060306    regulation of membrane repolarization    Any process that modulates the establishment or extent of a membrane potential in the polarizing direction towards the resting potential, usually from positive to negative.
    GO:1901379    regulation of potassium ion transmembrane transport    Any process that modulates the frequency, rate or extent of potassium ion transmembrane transport.
    GO:0060307    regulation of ventricular cardiac muscle cell membrane repolarization    Any process that modulates the establishment or extent of a membrane potential in the polarizing direction towards the resting potential in a ventricular cardiomyocyte.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
    GO:0055085    transmembrane transport    The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0086005    ventricular cardiac muscle cell action potential    An action potential that occurs in a ventricular cardiac muscle cell.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ujl)
 
  Sites
(no "Sites" information available for 1ujl)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ujl)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ujl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KCNH2_HUMAN | Q12809
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  609620
    Disease InformationOMIM
  613688
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KCNH2_HUMAN | Q12809
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KCNH2_HUMAN | Q128091byw 2l0w 2l1m 2l4r 2le7 2n7g 4hp9 4hqa 5va1 5va2 5va3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UJL)