1BYW - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   STRUCTURE OF THE N-TERMINAL DOMAIN OF THE HUMAN-ERG POTASSIUM CHANNEL

Authors :   J. H. M. Cabral, A. Lee, R. Mackinnon

Date :   15 Oct 98 (Deposition) - 16 Dec 98 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym./Biol. Unit : A

Keywords :   Pas Domain, Potassium Channel Domain, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. H. M. Cabral, A. Lee, S. L. Cohen, B. T. Chait, M. Li, R. Mackinnon
Crystal Structure And Functional Analysis Of The Herg Potassium Channel N-Terminus: A Eukaryotic Pas Domain
Cell(Cambridge, Mass. ) V. 95 649 1998
PubMed-ID: 9845367 | Reference-DOI: 10.1016/S0092-8674(00)81635-9
(for further references see the PDB file header)

Molecule 1 - PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
	Cellular Location	:	CELL MEMBRANE
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Cellular Location	:	CYTOPLASM
	Expression System Plasmid	:	PGEX-4T2
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	N-TERMINAL DOMAIN
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1BYW)

(no "Site" information available for 1BYW)

(no "SS Bond" information available for 1BYW)

(no "Cis Peptide Bond" information available for 1BYW)

Asymmetric/Biological Unit (46, 46)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_068249	S	26	I	KCNH2_HUMAN	Disease (LQT2)	199472827	A	S	26	I
02	UniProt	VAR_008907	F	29	L	KCNH2_HUMAN	Disease (LQT2)	199472830	A	F	29	L
03	UniProt	VAR_074767	I	30	T	KCNH2_HUMAN	Unclassified (LQT2)	199472832	A	I	30	T
04	UniProt	VAR_068250	I	31	S	KCNH2_HUMAN	Disease (LQT2)	199472833	A	I	31	S
05	UniProt	VAR_074768	A	32	T	KCNH2_HUMAN	Unclassified (LQT2)	199472834	A	A	32	T
06	UniProt	VAR_008908	N	33	T	KCNH2_HUMAN	Disease (LQT2)	199473487	A	N	33	T
07	UniProt	VAR_074769	V	41	F	KCNH2_HUMAN	Unclassified (LQT2)	199472835	A	V	41	F
08	UniProt	VAR_074770	Y	43	C	KCNH2_HUMAN	Unclassified (LQT2)	199472836	A	Y	43	C
09	UniProt	VAR_074771	N	45	Y	KCNH2_HUMAN	Unclassified (LQT2)	199472839	A	N	45	Y
10	UniProt	VAR_009909	G	47	V	KCNH2_HUMAN	Disease (LQT2)	199473490	A	G	47	V
11	UniProt	VAR_074772	C	49	Y	KCNH2_HUMAN	Unclassified (LQT2)	199472840	A	C	49	Y
12	UniProt	VAR_074773	G	53	D	KCNH2_HUMAN	Unclassified (LQT2)	199473491	A	G	53	D
13	UniProt	VAR_008909	G	53	R	KCNH2_HUMAN	Disease (LQT2)	199472842	A	G	53	R
14	UniProt	VAR_074774	Y	54	H	KCNH2_HUMAN	Unclassified (LQT2)	199472843	A	Y	54	H
15	UniProt	VAR_068251	S	55	L	KCNH2_HUMAN	Disease (LQT2)	199472844	A	S	55	L
16	UniProt	VAR_008910	R	56	Q	KCNH2_HUMAN	Disease (LQT2)	199472845	A	R	56	Q
17	UniProt	VAR_074775	A	57	P	KCNH2_HUMAN	Unclassified (LQT2)	199472846	A	A	57	P
18	UniProt	VAR_074776	E	58	A	KCNH2_HUMAN	Unclassified (LQT2)	199472847	A	E	58	A
19	UniProt	VAR_074777	E	58	D	KCNH2_HUMAN	Unclassified (LQT2)	199473492	A	E	58	D
20	UniProt	VAR_074778	E	58	G	KCNH2_HUMAN	Unclassified (LQT2)	199472847	A	E	58	G
21	UniProt	VAR_074779	C	64	W	KCNH2_HUMAN	Unclassified (LQT2)	199473414	A	C	64	W
22	UniProt	VAR_077953	C	64	Y	KCNH2_HUMAN	Disease (LQT2)	199473415	A	C	64	Y
23	UniProt	VAR_014371	T	65	P	KCNH2_HUMAN	Disease (LQT2)	28933095	A	T	65	P
24	UniProt	VAR_008911	C	66	G	KCNH2_HUMAN	Disease (LQT2)	199473416	A	C	66	G
25	UniProt	VAR_074780	F	68	L	KCNH2_HUMAN	Unclassified (LQT2)	199473417	A	F	68	L
26	UniProt	VAR_074781	H	70	N	KCNH2_HUMAN	Unclassified (LQT2)	199473418	A	H	70	N
27	UniProt	VAR_008912	H	70	R	KCNH2_HUMAN	Disease (LQT2)	199473419	A	H	70	R
28	UniProt	VAR_074782	G	71	R	KCNH2_HUMAN	Unclassified (LQT2)	199473420	A	G	71	R
29	UniProt	VAR_074784	P	72	L	KCNH2_HUMAN	Unclassified (LQT2)	199473421	A	P	72	L
30	UniProt	VAR_009910	P	72	Q	KCNH2_HUMAN	Unclassified (LQT2)	199473421	A	P	72	Q
31	UniProt	VAR_074785	T	74	M	KCNH2_HUMAN	Disease (LQT2)	199473422	A	T	74	M
32	UniProt	VAR_074786	T	74	P	KCNH2_HUMAN	Unclassified (LQT2)	199473666	A	T	74	P
33	UniProt	VAR_074787	T	74	R	KCNH2_HUMAN	Unclassified (LQT2)	199473422	A	T	74	R
34	UniProt	VAR_008913	A	78	P	KCNH2_HUMAN	Disease (LQT2)	199472848	A	A	78	P
35	UniProt	VAR_068252	A	85	V	KCNH2_HUMAN	Disease (LQT2)	199473494	A	A	85	V
36	UniProt	VAR_074788	L	86	P	KCNH2_HUMAN	Unclassified (LQT2)	199472851	A	L	86	P
37	UniProt	VAR_008914	L	86	R	KCNH2_HUMAN	Disease (LQT2)	199472851	A	L	86	R
38	UniProt	VAR_074789	V	94	G	KCNH2_HUMAN	Unclassified (LQT2)	199472852	A	V	94	G
39	UniProt	VAR_036669	R	100	G	KCNH2_HUMAN	Disease (LQT2)	121912515	A	R	100	G
40	UniProt	VAR_068253	R	100	Q	KCNH2_HUMAN	Disease (LQT2)	199472855	A	R	100	Q
41	UniProt	VAR_074790	R	100	W	KCNH2_HUMAN	Unclassified (LQT2)	121912515	A	R	100	W
42	UniProt	VAR_074791	D	102	A	KCNH2_HUMAN	Unclassified (LQT2)	199472857	A	D	102	A
43	UniProt	VAR_074792	F	106	Y	KCNH2_HUMAN	Unclassified (LQT2)	199472858	A	F	106	Y
44	UniProt	VAR_074793	C	108	R	KCNH2_HUMAN	Unclassified (LQT2)	199472859	A	C	108	R
45	UniProt	VAR_074794	P	114	S	KCNH2_HUMAN	Unclassified (LQT2)	199472861	A	P	114	S
46	UniProt	VAR_074795	F	125	C	KCNH2_HUMAN	Unclassified (LQT2)	199473499	A	F	125	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PAS	PS50112	PAS repeat profile.	KCNH2_HUMAN	41-70	1	A:41-70
2	PAC	PS50113	PAC domain profile.	KCNH2_HUMAN	92-144	1	A:92-135

Asymmetric/Biological Unit (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000262186	1a	ENSE00001475694	chr7:150675403-150674926	478	KCNH2_HUMAN	1-26	26	1	A:26-26	1
1.2	ENST00000262186	2	ENSE00001141390	chr7:150672029-150671799	231	KCNH2_HUMAN	26-103	78	1	A:26-103	78
1.3	ENST00000262186	3	ENSE00001141475	chr7:150656824-150656660	165	KCNH2_HUMAN	103-158	56	1	A:103-135	33
1.4	ENST00000262186	4	ENSE00000729926	chr7:150655590-150655147	444	KCNH2_HUMAN	158-306	149	0	-	-
1.5	ENST00000262186	5	ENSE00000909768	chr7:150654590-150654379	212	KCNH2_HUMAN	306-376	71	0	-	-
1.7	ENST00000262186	7	ENSE00000909766	chr7:150649941-150649513	429	KCNH2_HUMAN	377-519	143	0	-	-
1.8a	ENST00000262186	8a	ENSE00000909764	chr7:150648923-150648536	388	KCNH2_HUMAN	520-649	130	0	-	-
1.8c	ENST00000262186	8c	ENSE00001677788	chr7:150648208-150648009	200	KCNH2_HUMAN	649-715	67	0	-	-
1.9a	ENST00000262186	9a	ENSE00001801009	chr7:150647508-150647256	253	KCNH2_HUMAN	716-800	85	0	-	-
1.10	ENST00000262186	10	ENSE00000978099	chr7:150646137-150645944	194	KCNH2_HUMAN	800-864	65	0	-	-
1.11	ENST00000262186	11	ENSE00000872389	chr7:150645631-150645532	100	KCNH2_HUMAN	865-898	34	0	-	-
1.12	ENST00000262186	12	ENSE00001141381	chr7:150644966-150644694	273	KCNH2_HUMAN	898-989	92	0	-	-
1.13	ENST00000262186	13	ENSE00001141375	chr7:150644602-150644416	187	KCNH2_HUMAN	989-1051	63	0	-	-
1.14	ENST00000262186	14	ENSE00001141370	chr7:150644142-150643965	178	KCNH2_HUMAN	1051-1110	60	0	-	-
1.15	ENST00000262186	15	ENSE00000872388	chr7:150642602-150642049	554	KCNH2_HUMAN	1111-1159	49	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:110
 aligned with KCNH2_HUMAN | Q12809 from UniProtKB/Swiss-Prot  Length:1159

    Alignment length:110
                                    35        45        55        65        75        85        95       105       115       125       135
          KCNH2_HUMAN    26 SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK 135
               SCOP domains d1bywa_ A: Erg potassium channel, N-terminal domain                                                            SCOP domains
               CATH domains 1bywA00 A:26-135  [code=3.30.450.20, no name defined]                                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.......eeee.hhhhhhh...hhhh.......hhh......hhhhhhhhhhhh....eeeeeeee.....eeeeeeeeeee........eeeeeeeeeee. Sec.struct. author
             SAPs(SNPs) (1) I--LTSTT-------F-C-Y-V-Y---DHLQPA-----WPG-L-NRL-M---P------VP-------G-----G-A---Y-R-----S----------C---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------R----D-----Y-----R-Q-P-----------R-------------Q----------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------------------G---------------R-------------------------W----------------------------------- SAPs(SNPs) (3)
                    PROSITE ---------------PAS  PDB: A:41-70             ---------------------PAC  PDB: A:92-135 UniProt: 92-144           PROSITE
           Transcript 1 (1) 1----------------------------------------------------------------------------Exon 1.3  PDB: A:103-135          Transcript 1 (1)
           Transcript 1 (2) Exon 1.2  PDB: A:26-103 UniProt: 26-103                                       -------------------------------- Transcript 1 (2)
                 1byw A  26 SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPCTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK 135
                                    35        45        55        65        75        85        95       105       115       125       135

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Profilin-like (304)

Superfamily: PYP-like sensor domain (PAS domain) (163)

Family: Flavin-binding PAS domain (17)

Protein domain: Erg potassium channel, N-terminal domain (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d1bywa_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Beta-Lactamase (202)

Homologous Superfamily: [code=3.30.450.20, no name defined] (117)

Human (Homo sapiens) (9)

1bywA00

A:26-135

(no "Pfam Domain" information available for 1BYW)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (KCNH2_HUMAN | Q12809)

molecular function
	GO:0055131	C3HC4-type RING finger domain binding	Interacting selectively and non-covalently with a C3HC4-type zinc finger domain of a protein. The C3HC4-type zinc finger is a variant of RING finger, is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C, where X is any amino acid. Many proteins containing a C3HC4-type RING finger play a key role in the ubiquitination pathway.
	GO:0005251	delayed rectifier potassium channel activity	Enables the transmembrane transfer of a potassium ion by a delayed rectifying voltage-gated channel. A delayed rectifying current-voltage relation is one where channel activation kinetics are time-dependent, and inactivation is slow.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005242	inward rectifier potassium channel activity	Enables the transmembrane transfer of a potassium ion by an inwardly-rectifying voltage-gated channel. An inwardly rectifying current-voltage relation is one where at any given driving force the inward flow of K+ ions exceeds the outward flow for the opposite driving force. The inward-rectification is due to a voltage-dependent block of the channel pore by a specific ligand or ligands, and as a result the macroscopic conductance depends on the difference between membrane voltage and the K+ equilibrium potential rather than on membrane voltage itself.
	GO:0005216	ion channel activity	Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
	GO:0000155	phosphorelay sensor kinase activity	Catalysis of the phosphorylation of a histidine residue in response to detection of an extracellular signal such as a chemical ligand or change in environment, to initiate a change in cell state or activity. The two-component sensor is a histidine kinase that autophosphorylates a histidine residue in its active site. The phosphate is then transferred to an aspartate residue in a downstream response regulator, to trigger a response.
	GO:0005267	potassium channel activity	Enables the facilitated diffusion of a potassium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0097110	scaffold protein binding	Interacting selectively and non-covalently with a scaffold protein. Scaffold proteins are crucial regulators of many key signaling pathways. Although not strictly defined in function, they are known to interact and/or bind with multiple members of a signaling pathway, tethering them into complexes.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
	GO:0005244	voltage-gated ion channel activity	Enables the transmembrane transfer of an ion by a voltage-gated channel. An ion is an atom or group of atoms carrying an electric charge by virtue of having gained or lost one or more electrons. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
	GO:0005249	voltage-gated potassium channel activity	Enables the transmembrane transfer of a potassium ion by a voltage-gated channel. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
	GO:0086008	voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization	Enables the transmembrane transfer of a potassium ion by a voltage-gated channel through the plasma membrane of a cardiac muscle cell contributing to the repolarization phase of an action potential. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
	GO:1902282	voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	Enables the transmembrane transfer of a potassium ion by a voltage-gated channel through the plasma membrane of a ventricular cardiomyocyte contributing to the repolarization phase of an action potential. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
biological process
	GO:0061337	cardiac conduction	Transfer of an organized electrical impulse across the heart to coordinate the contraction of cardiac muscles. The process begins with generation of an action potential (in the sinoatrial node (SA) in humans) and ends with a change in the rate, frequency, or extent of the contraction of the heart muscles.
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0035690	cellular response to drug	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0086010	membrane depolarization during action potential	The process in which membrane potential changes in the depolarizing direction from the negative resting potential towards the positive membrane potential that will be the peak of the action potential.
	GO:0086011	membrane repolarization during action potential	The process in which ions are transported across a membrane such that the membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
	GO:0086013	membrane repolarization during cardiac muscle cell action potential	The process in which ions are transported across a membrane such that the cardiac muscle cell plasma membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
	GO:0098915	membrane repolarization during ventricular cardiac muscle cell action potential	The process in which ions are transported across a membrane such that the ventricular cardiomyocyte membrane potential changes in the direction from the positive membrane potential at the peak of the action potential towards the negative resting potential.
	GO:1902303	negative regulation of potassium ion export	Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion export.
	GO:1901380	negative regulation of potassium ion transmembrane transport	Any process that stops, prevents or reduces the frequency, rate or extent of potassium ion transmembrane transport.
	GO:0000160	phosphorelay signal transduction system	A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
	GO:1901381	positive regulation of potassium ion transmembrane transport	Any process that activates or increases the frequency, rate or extent of potassium ion transmembrane transport.
	GO:0071435	potassium ion export	The directed movement of potassium ions out of a cell or organelle.
	GO:0097623	potassium ion export across plasma membrane	The directed movement of potassium ions from inside of a cell, across the plasma membrane and into the extracellular region.
	GO:0055075	potassium ion homeostasis	Any process involved in the maintenance of an internal steady state of potassium ions within an organism or cell.
	GO:0071805	potassium ion transmembrane transport	A process in which a potassium ion is transported from one side of a membrane to the other.
	GO:0006813	potassium ion transport	The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0086091	regulation of heart rate by cardiac conduction	A cardiac conduction process that modulates the frequency or rate of heart contraction.
	GO:0003064	regulation of heart rate by hormone	The process in which the hormones modulates the rate of heart muscle contraction. A hormone is one of a group of substances formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells, in the same organism, upon which they have a specific regulatory action.
	GO:0034765	regulation of ion transmembrane transport	Any process that modulates the frequency, rate or extent of the directed movement of ions from one side of a membrane to the other.
	GO:0042391	regulation of membrane potential	Any process that modulates the establishment or extent of a membrane potential, the electric potential existing across any membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
	GO:0060306	regulation of membrane repolarization	Any process that modulates the establishment or extent of a membrane potential in the polarizing direction towards the resting potential, usually from positive to negative.
	GO:1901379	regulation of potassium ion transmembrane transport	Any process that modulates the frequency, rate or extent of potassium ion transmembrane transport.
	GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization	Any process that modulates the establishment or extent of a membrane potential in the polarizing direction towards the resting potential in a ventricular cardiomyocyte.
	GO:0023014	signal transduction by protein phosphorylation	A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0086005	ventricular cardiac muscle cell action potential	An action potential that occurs in a ventricular cardiac muscle cell.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0008076	voltage-gated potassium channel complex	A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1byw)

	Sites
(no "Sites" information available for 1byw)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1byw)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1byw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	KCNH2_HUMAN \| Q12809
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	613688
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	KCNH2_HUMAN \| Q12809
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	KCNH2_HUMAN \| Q12809	:	1ujl 2l0w 2l1m 2l4r 2le7 2n7g 4hp9 4hqa 5va1 5va2 5va3

(no "Related Entries Specified in the PDB File" available for 1BYW)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (46, 46)

PROSITE Motifs (2, 2)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (49, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File