|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2KKD) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KKD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KKD) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2KKD) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:52 aligned with RUBR_DESVH | P00269 from UniProtKB/Swiss-Prot Length:52 Alignment length:52 10 20 30 40 50 RUBR_DESVH 1 MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA 52 SCOP domains d2kkda_ A: Rubredoxin SCOP domains CATH domains 2kkdA00 A:1-52 [code=2.20.28.10, no name defined] CATH domains Pfam domains --Rubredoxin-2kkdA01 A:3-49 --- Pfam domains SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs) PROSITE (1) RUBREDOXIN_LIKE PDB: A:1-52 UniProt: 1-52 PROSITE (1) PROSITE (2) --------------------------------RUBREDOXIN --------- PROSITE (2) Transcript ---------------------------------------------------- Transcript 2kkd A 1 MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA 52 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (RUBR_DESVH | P00269)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|