|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KJC) |
Sites (0, 0)| (no "Site" information available for 2KJC) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KJC) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KJC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KJC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KJC) |
Exons (0, 0)| (no "Exon" information available for 2KJC) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:95 aligned with O85142_STAAU | O85142 from UniProtKB/TrEMBL Length:106 Alignment length:95 18 28 38 48 58 68 78 88 98 O85142_STAAU 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 SCOP domains d2kjca_ A: automated matches SCOP domains CATH domains 2kjcA00 A:9-103 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 2kjc A 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 18 28 38 48 58 68 78 88 98 Chain B from PDB Type:PROTEIN Length:95 aligned with O85142_STAAU | O85142 from UniProtKB/TrEMBL Length:106 Alignment length:95 18 28 38 48 58 68 78 88 98 O85142_STAAU 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 SCOP domains d2kjcb_ B: automated matches SCOP domains CATH domains 2kjcB00 B:9-103 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) --------HTH_20-2kjcB01 B:17-76 --------------------------- Pfam domains (1) Pfam domains (2) --------HTH_20-2kjcB02 B:17-76 --------------------------- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 2kjc B 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 18 28 38 48 58 68 78 88 98
|
||||||||||||||||||||
SCOP Domains (1, 2)
NMR Structure
|
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A,B (O85142_STAAU | O85142)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|