|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2KJB) |
(no "Site" information available for 2KJB) |
(no "SS Bond" information available for 2KJB) |
(no "Cis Peptide Bond" information available for 2KJB) |
(no "SAP(SNP)/Variant" information available for 2KJB) |
(no "PROSITE Motif" information available for 2KJB) |
(no "Exon" information available for 2KJB) |
NMR StructureChain A from PDB Type:PROTEIN Length:95 aligned with O85142_STAAU | O85142 from UniProtKB/TrEMBL Length:106 Alignment length:95 18 28 38 48 58 68 78 88 98 O85142_STAAU 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 SCOP domains d2kjba_ A: automated matches SCOP domains CATH domains 2kjbA00 A:9-103 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 2kjb A 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 18 28 38 48 58 68 78 88 98 Chain B from PDB Type:PROTEIN Length:95 aligned with O85142_STAAU | O85142 from UniProtKB/TrEMBL Length:106 Alignment length:95 18 28 38 48 58 68 78 88 98 O85142_STAAU 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 SCOP domains d2kjbb_ B: automated matches SCOP domains CATH domains 2kjbB00 B:9-103 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) --------HTH_20-2kjbB01 B:17-76 --------------------------- Pfam domains (1) Pfam domains (2) --------HTH_20-2kjbB02 B:17-76 --------------------------- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 2kjb B 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 18 28 38 48 58 68 78 88 98
|
NMR Structure
|
NMR Structure |
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A,B (O85142_STAAU | O85142)
|
|
|
|
|
|
|