|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric Unit (1, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1R1V) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1R1V) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1R1V) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1R1V) |
Exons (0, 0)| (no "Exon" information available for 1R1V) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:95 aligned with O85142_STAAU | O85142 from UniProtKB/TrEMBL Length:106 Alignment length:95 18 28 38 48 58 68 78 88 98 O85142_STAAU 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 SCOP domains d1r1va_ A: Metal-sensing transcriptional repressor CzrA SCOP domains CATH domains 1r1vA00 A:9-103 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 1r1v A 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE 103 18 28 38 48 58 68 78 88 98 Chain B from PDB Type:PROTEIN Length:96 aligned with O85142_STAAU | O85142 from UniProtKB/TrEMBL Length:106 Alignment length:96 18 28 38 48 58 68 78 88 98 O85142_STAAU 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKES 104 SCOP domains d1r1vb_ B: Metal-sensing transcriptional repressor CzrA SCOP domains CATH domains 1r1vB00 B:9-104 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) --------HTH_20-1r1vB01 B:17-76 ---------------------------- Pfam domains (1) Pfam domains (2) --------HTH_20-1r1vB02 B:17-76 ---------------------------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 1r1v B 9 NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKES 104 18 28 38 48 58 68 78 88 98
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (O85142_STAAU | O85142)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|