2JMX - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   OSCP-NT (1-120) IN COMPLEX WITH N-TERMINAL (1-25) ALPHA SUBUNIT FROM F1-ATPASE

Authors :   R. J. Carbajo, D. Neuhaus, F. A. Kellas, J. Yang, M. J. Runswick, M. G. Montgomery, J. E. Walker

Date :   12 Dec 06 (Deposition) - 24 Apr 07 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (30x)

Keywords :   Oscp-Nt Alpha-Nt Complex, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. J. Carbajo, F. A. Kellas, J. -C. Yang, M. J. Runswick, M. G. Montgomery, J. E. Walker, D. Neuhaus
How The N-Terminal Domain Of The Oscp Subunit Of Bovine F(1)F(O)-Atp Synthase Interacts With The N-Terminal Region Of An Alpha Subunit
J. Mol. Biol. V. 368 310 2007
PubMed-ID: 17355883 | Reference-DOI: 10.1016/J.JMB.2007.02.059
(for further references see the PDB file header)

Molecule 1 - ATP SYNTHASE O SUBUNIT, MITOCHONDRIAL
	Chains	:	A
	EC Number	:	3.6.3.14
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector	:	PET10
	Expression System Vector Type	:	VECTOR
	Fragment	:	ATP SYNTHASE O SUBUNIT, RESIDUES 1-120
	Gene	:	ATP5O
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Synonym	:	OLIGOMYCIN SENSITIVITY CONFERRAL PROTEIN, OSCP

Molecule 2 - ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL
	Chains	:	B
	EC Number	:	3.6.3.14
	Engineered	:	YES
	Fragment	:	ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, RESIDUES 1-25
	Other Details	:	THE ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM IS NATURALLY FOUND IN BOS TAURUS.
	Synonym	:	F1-ATPASE
	Synthetic	:	YES


NMR Structure (30x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2JMX)

(no "Site" information available for 2JMX)

(no "SS Bond" information available for 2JMX)

(no "Cis Peptide Bond" information available for 2JMX)

(no "SAP(SNP)/Variant" information available for 2JMX)

(no "PROSITE Motif" information available for 2JMX)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000024326	1	ENSBTAE00000197898	chr1:720699-720764	66	ATPO_BOVIN	1-12	12	0	-	-
1.2	ENSBTAT00000024326	2	ENSBTAE00000401349	chr1:722101-722151	51	ATPO_BOVIN	13-29	17	1	A:1-6	6
1.3	ENSBTAT00000024326	3	ENSBTAE00000197900	chr1:723098-723208	111	ATPO_BOVIN	30-66	37	1	A:7-43	37
1.4	ENSBTAT00000024326	4	ENSBTAE00000197901	chr1:725362-725491	130	ATPO_BOVIN	67-110	44	1	A:44-87	44
1.5	ENSBTAT00000024326	5	ENSBTAE00000197902	chr1:726174-726286	113	ATPO_BOVIN	110-147	38	1	A:87-120	34
1.6	ENSBTAT00000024326	6	ENSBTAE00000398411	chr1:727512-727598	87	ATPO_BOVIN	148-176	29	0	-	-
1.7	ENSBTAT00000024326	7	ENSBTAE00000197904	chr1:727876-728057	182	ATPO_BOVIN	177-213	37	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:120
 aligned with ATPO_BOVIN | P13621 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:120
                                    33        43        53        63        73        83        93       103       113       123       133       143
           ATPO_BOVIN    24 FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTV 143
               SCOP domains ------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -------------OSCP-2jmxA01 A:14-120                                                                                       Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh......hhhhhhh......hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.2   Exon 1.3  PDB: A:7-43 UniProt: 30-66 Exon 1.4  PDB: A:44-87 UniProt: 67-110      --------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------Exon 1.5  PDB: A:87-120            Transcript 1 (2)
                 2jmx A   1 FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTV 120
                                    10        20        30        40        50        60        70        80        90       100       110       120

Chain B from PDB  Type:PROTEIN  Length:25
 aligned with ATPA_BOVIN | P19483 from UniProtKB/Swiss-Prot  Length:553

    Alignment length:25
                                    53        63     
           ATPA_BOVIN    44 QKTGTAEVSSILEERILGADTSVDL  68
               SCOP domains ------------------------- SCOP domains
               CATH domains ------------------------- CATH domains
               Pfam domains ------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------- SAPs(SNPs)
                    PROSITE ------------------------- PROSITE
                 Transcript ------------------------- Transcript
                 2jmx B   1 QKTGTAEVSSILEERILGADTSVDL  25
                                    10        20

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2JMX)

(no "CATH Domain" information available for 2JMX)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: ATP_synthase (9)

Family: OSCP (2)

Bos taurus (Bovine) (2)

OSCP-2jmxA01

A:14-120

NMR Structure(hide GO term definitions)

Chain A (ATPO_BOVIN | P13621)

molecular function
	GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
biological process
	GO:0006754	ATP biosynthetic process	The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0015986	ATP synthesis coupled proton transport	The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005753	mitochondrial proton-transporting ATP synthase complex	A proton-transporting ATP synthase complex found in the mitochondrial membrane.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.

Chain B (ATPA_BOVIN | P19483)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016820	hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances	Catalysis of the hydrolysis of an acid anhydride to directly drive the transport of a substance across a membrane.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
	GO:0046961	proton-transporting ATPase activity, rotational mechanism	Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ATP + H2O + H+(in) = ADP + phosphate + H+(out), by a rotational mechanism.
biological process
	GO:0006754	ATP biosynthetic process	The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0015991	ATP hydrolysis coupled proton transport	The transport of protons against an electrochemical gradient, using energy from ATP hydrolysis.
	GO:0046034	ATP metabolic process	The chemical reactions and pathways involving ATP, adenosine triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0015986	ATP synthesis coupled proton transport	The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005753	mitochondrial proton-transporting ATP synthase complex	A proton-transporting ATP synthase complex found in the mitochondrial membrane.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0045261	proton-transporting ATP synthase complex, catalytic core F(1)	The sector of a hydrogen-transporting ATP synthase complex in which the catalytic activity resides; it comprises the catalytic core and central stalk, and is peripherally associated with a membrane, such as the plasma membrane or the mitochondrial inner membrane, when the entire ATP synthase is assembled.
	GO:0033178	proton-transporting two-sector ATPase complex, catalytic domain	A protein complex that forms part of a proton-transporting two-sector ATPase complex and catalyzes ATP hydrolysis or synthesis. The catalytic domain (F1, V1, or A1) comprises a hexameric catalytic core and a central stalk, and is peripherally associated with the membrane when the two-sector ATPase is assembled.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jmx)

	Sites
(no "Sites" information available for 2jmx)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jmx)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2jmx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ATPA_BOVIN \| P19483
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ATPO_BOVIN \| P13621
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.3.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ATPA_BOVIN \| P19483
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ATPO_BOVIN \| P13621
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (21, 31)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File