2ILT - JenaLib

Title :   HUMAN 11-BETA-HYDROXYSTEROID DEHYDROGENASE (HSD1) WITH NADP AND ADAMANTANE SULFONE INHIBITOR

Authors :   K. L. Longenecker, B. Sorensen, R. Judge, W. Qin, J. T. Link

Date :   03 Oct 06 (Deposition) - 03 Apr 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)
Biol. Unit 2: A  (12x)

Keywords :   Hsd1, Nadp, Inhibitor, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. Sorensen, M. Winn, J. Rohde, Q. Shuai, J. Wang, S. Fung, K. Monzon, W. Chiou, D. Stolarik, H. Imade, L. Pan, X. Deng, L. Chovan, K. Longenecker, R. Judge, W. Qin, M. Brune, H. Camp, E. U. Frevert, P. Jacobson, J. T. Link
Adamantane Sulfone And Sulfonamide 11-Beta-Hsd1 Inhibitors.
Bioorg. Med. Chem. Lett. V. 17 527 2007
PubMed-ID: 17070044 | Reference-DOI: 10.1016/J.BMCL.2006.10.008

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 4)

Asymmetric Unit (3, 4)

No.	Name	Count	Type	Full Name
1	NAP	1	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
2	NI	2	Ligand/Ion	NICKEL (II) ION
3	NN1	1	Ligand/Ion	2-(2-CHLORO-4-FLUOROPHENOXY)-2-METHYL-N-[(1R,2S,3S,5S,7S)-5-(METHYLSULFONYL)-2-ADAMANTYL]PROPANAMIDE

Biological Unit 1 (2, 4)

No.	Name	Count	Type	Full Name
1	NAP	2	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
2	NI	-1	Ligand/Ion	NICKEL (II) ION
3	NN1	2	Ligand/Ion	2-(2-CHLORO-4-FLUOROPHENOXY)-2-METHYL-N-[(1R,2S,3S,5S,7S)-5-(METHYLSULFONYL)-2-ADAMANTYL]PROPANAMIDE

Biological Unit 2 (2, 24)

No.	Name	Count	Type	Full Name
1	NAP	12	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
2	NI	-1	Ligand/Ion	NICKEL (II) ION
3	NN1	12	Ligand/Ion	2-(2-CHLORO-4-FLUOROPHENOXY)-2-METHYL-N-[(1R,2S,3S,5S,7S)-5-(METHYLSULFONYL)-2-ADAMANTYL]PROPANAMIDE

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

Asymmetric Unit (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035845	V	148	E	DHI1_HUMAN	Unclassified	---	A	V	148	E
2	CancerSNP	VAR_DHI1_HUMAN_CCDS1489_1_01 *	V	148	E	DHI1_HUMAN	Disease (Breast cancer)	---	A	V	148	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035845	V	148	E	DHI1_HUMAN	Unclassified	---	A	V	148	E
2	CancerSNP	VAR_DHI1_HUMAN_CCDS1489_1_01 *	V	148	E	DHI1_HUMAN	Disease (Breast cancer)	---	A	V	148	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 24)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035845	V	148	E	DHI1_HUMAN	Unclassified	---	A	V	148	E
2	CancerSNP	VAR_DHI1_HUMAN_CCDS1489_1_01 *	V	148	E	DHI1_HUMAN	Disease (Breast cancer)	---	A	V	148	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 1)

Exons (6, 6)

Asymmetric Unit (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000367028	1a	ENSE00001443288	chr1:209859510-209859630	121	DHI1_HUMAN	-	0	0	-	-
1.2b	ENST00000367028	2b	ENSE00001443287	chr1:209878240-209878375	136	DHI1_HUMAN	1-30	30	1	A:11-30 (gaps)	27
1.3	ENST00000367028	3	ENSE00000792110	chr1:209879156-209879286	131	DHI1_HUMAN	30-73	44	1	A:30-73	44
1.4	ENST00000367028	4	ENSE00000792111	chr1:209880054-209880165	112	DHI1_HUMAN	74-111	38	1	A:74-111	38
1.5	ENST00000367028	5	ENSE00000792112	chr1:209880288-209880473	186	DHI1_HUMAN	111-173	63	1	A:111-173	63
1.6	ENST00000367028	6	ENSE00000792113	chr1:209905781-209905924	144	DHI1_HUMAN	173-221	49	1	A:173-221	49
1.7a	ENST00000367028	7a	ENSE00001443286	chr1:209907649-209908209	561	DHI1_HUMAN	221-292	72	1	A:221-285	65

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:275
 aligned with DHI1_HUMAN | P28845 from UniProtKB/Swiss-Prot  Length:292

    Alignment length:282
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283  
           DHI1_HUMAN     4 MKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYN 285
               SCOP domains d2ilta       _ A: 11-beta-hydroxysteroid dehydrogenase 1                                                                                                                                                                                                                                   SCOP domains
               CATH domains ------------------------2iltA01 A:28-285 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......-------...........hhhhh...eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh..eeeeee....hhhhhhhhhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee....hhhhhhhhh........hhhhhhhhhhhhhhh...eeee..hhhhhhhh.hhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------------------------------------------------------------------------------------------------------------------------E----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------E----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------ADH_SHORT  PDB: A:170-198    --------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2b UniProt: 1-30    -------------------------------------------Exon 1.4  PDB: A:74-111               -------------------------------------------------------------Exon 1.6  PDB: A:173-221 UniProt: 173-221        ---------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------Exon 1.3  PDB: A:30-73 UniProt: 30-73       -------------------------------------Exon 1.5  PDB: A:111-173 UniProt: 111-173                      -----------------------------------------------Exon 1.7a  PDB: A:221-285 UniProt: 221-292 [INCOMPLETE]           Transcript 1 (2)
                 2ilt A  11 QHQHQH-------QHQHQQPNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN 285
                                 |   -   |    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283  
                                16      17

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (12, 12)

Asymmetric Unit(hide GO term definitions)

Chain A (DHI1_HUMAN | P28845)

molecular function
	GO:0070524	11-beta-hydroxysteroid dehydrogenase (NADP+) activity	Catalysis of the reaction: an 11-beta-hydroxysteroid + NADP+ = an 11-oxosteroid + NADPH + H+.
	GO:0003845	11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity	Catalysis of the reaction: an 11-beta-hydroxysteroid + NAD(P)+ = an 11-oxosteroid + NAD(P)H + H(+).
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0006704	glucocorticoid biosynthetic process	The chemical reactions and pathways resulting in the formation of glucocorticoids, hormonal C21 corticosteroids synthesized from cholesterol.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0030324	lung development	The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
cellular component
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NI	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NN1	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ilt)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2ilt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DHI1_HUMAN \| P28845
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.146
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description