![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 15) |
Asymmetric Unit (5, 5)
|
(no "SS Bond" information available for 2I9X) |
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 2I9X) |
(no "PROSITE Motif" information available for 2I9X) |
(no "Exon" information available for 2I9X) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:86 aligned with SP5G_STAES | Q8CML1 from UniProtKB/Swiss-Prot Length:102 Alignment length:86 1 | 8 18 28 38 48 58 68 78 SP5G_STAES - --MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETD 84 SCOP domains --d2i9xa1 A:1-84 Putative septation protein SpoVG SCOP domains CATH domains 2i9xA00 A:-1-84 SpoVG-like domains CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 2i9x A -1 NAmKVTDVRLRKIQTDGRmKALVSITLDEAFVIHDLRVIEGNSGLFVAmPSKRTPDGEFRDIAHPINSDmRQEIQDAVmKVYDETD 84 | 8 18 28 38 48 58 68 78 | 17-MSE 47-MSE 68-MSE 77-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:85 aligned with SP5G_STAES | Q8CML1 from UniProtKB/Swiss-Prot Length:102 Alignment length:85 1 | 9 19 29 39 49 59 69 79 SP5G_STAES - -MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETD 84 SCOP domains d2i9xb_ B: Putative septation protein SpoVG SCOP domains CATH domains 2i9xB00 B:0-84 SpoVG-like domains CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 2i9x B 0 AmKVTDVRLRKIQTDGRmKALVSITLDEAFVIHDLRVIEGNSGLFVAmPSKRTPDGEFRDIAHPINSDmRQEIQDAVmKVYDETD 84 | 9 |19 29 39 |49 59 69 |79 1-MSE 17-MSE 47-MSE 68-MSE 77-MSE
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "Pfam Domain" information available for 2I9X) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SP5G_STAES | Q8CML1)
|
|
|
|
|
|
|