![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 14) |
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 2I9Z) |
(no "Cis Peptide Bond" information available for 2I9Z) |
(no "SAP(SNP)/Variant" information available for 2I9Z) |
(no "PROSITE Motif" information available for 2I9Z) |
(no "Exon" information available for 2I9Z) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:87 aligned with SP5G_STAES | Q8CML1 from UniProtKB/Swiss-Prot Length:102 Alignment length:87 10 20 30 40 50 60 70 80 SP5G_STAES 1 MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVI 87 SCOP domains d2i9za1 A:1-87 Putative septation protein SpoVG SCOP domains CATH domains -2i9zA00 A:2-87 SpoVG-like domains CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 2i9z A 1 mKVTDVRLRKIQTDGRmKALVSITLDEAFVIHDLRVIEGNSGLFVAmPSKRTPDGEFRDIAHPINSDmRQEIQDAVmKVYDETDEVI 87 | 10 | 20 30 40 | 50 60 |70 | 80 | 17-MSE 47-MSE 68-MSE 77-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:84 aligned with SP5G_STAES | Q8CML1 from UniProtKB/Swiss-Prot Length:102 Alignment length:84 10 20 30 40 50 60 70 80 SP5G_STAES 1 MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETD 84 SCOP domains d2i9zb_ B: Putative septation protein SpoVG SCOP domains CATH domains -2i9zB00 B:2-84 SpoVG-like domains CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2i9z B 1 mKVTDVRLRKIQTDGRmKALVSITLDEAFVIHDLRVIEGNSGLFVAmPSKRTPDGEFRDIAHPINSDmRQEIQDAVmKVYDETD 84 | 10 | 20 30 40 | 50 60 |70 | 80 1-MSE 17-MSE 47-MSE 68-MSE 77-MSE
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "Pfam Domain" information available for 2I9Z) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SP5G_STAES | Q8CML1)
|
|
|
|
|
|
|