Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  E. COLI QUINOL FUMARATE REDUCTASE FRDA E49Q MUTATION
 
Authors :  E. Maklashina, T. M. Iverson, Y. Sher, V. Kotlyar, O. Mirza, J. Andrell, J. M. Hudson, F. A. Armstrong, G. Cecchini
Date :  03 Oct 05  (Deposition) - 21 Feb 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.30
Chains :  Asym. Unit :  A,B,C,D,M,N,O,P
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  M,N,O,P  (1x)
Keywords :  Fumarate Reductase, Succinate Dehydrogenase, Electron Transfer, Respiration, Krebs Cycle, Membrane Protein, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Maklashina, T. M. Iverson, Y. Sher, V. Kotlyar, J. Andrell, O. Mirza J. M. Hudson, F. A. Armstrong, R. A. Rothery, J. H. Weiner, G. Cecchini
Fumarate Reductase And Succinate Oxidase Activity Of Escherichia Coli Complex Ii Homologs Are Perturbed Differently By Mutation Of The Flavin Binding Domain
J. Biol. Chem. V. 281 11357 2006
PubMed-ID: 16484232  |  Reference-DOI: 10.1074/JBC.M512544200

(-) Compounds

Molecule 1 - FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    ChainsA, M
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPH3
    Expression System StrainDW35
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneFRDA
    MutationYES
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
 
Molecule 2 - FUMARATE REDUCTASE IRON-SULFUR PROTEIN
    ChainsB, N
    EC Number1.3.99.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPH3
    Expression System StrainDW35
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneFRDB
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
 
Molecule 3 - FUMARATE REDUCTASE SUBUNIT C
    ChainsC, O
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPH3
    Expression System StrainDW35
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneFRDC
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymFUMARATE REDUCTASE 15 KDA HYDROPHOBIC PROTEIN
 
Molecule 4 - FUMARATE REDUCTASE SUBUNIT D
    ChainsD, P
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPH3
    Expression System StrainDW35
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneFRDD
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymFUMARATE REDUCTASE 13 KDA HYDROPHOBIC PROTEIN

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDMNOP
Biological Unit 1 (1x)ABCD    
Biological Unit 2 (1x)    MNOP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 12)

Asymmetric Unit (6, 12)
No.NameCountTypeFull Name
1F3S2Ligand/IonFE3-S4 CLUSTER
2FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
4FLC2Ligand/IonCITRATE ANION
5MQ72Ligand/IonMENAQUINONE-7
6SF42Ligand/IonIRON/SULFUR CLUSTER
Biological Unit 1 (6, 6)
No.NameCountTypeFull Name
1F3S1Ligand/IonFE3-S4 CLUSTER
2FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
4FLC1Ligand/IonCITRATE ANION
5MQ71Ligand/IonMENAQUINONE-7
6SF41Ligand/IonIRON/SULFUR CLUSTER
Biological Unit 2 (6, 6)
No.NameCountTypeFull Name
1F3S1Ligand/IonFE3-S4 CLUSTER
2FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
3FES1Ligand/IonFE2/S2 (INORGANIC) CLUSTER
4FLC1Ligand/IonCITRATE ANION
5MQ71Ligand/IonMENAQUINONE-7
6SF41Ligand/IonIRON/SULFUR CLUSTER

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLN A:230 , HIS A:232 , THR A:244 , GLU A:245 , ARG A:287 , HIS A:355 , ARG A:390 , GLY A:392 , SER A:393 , FAD A:703BINDING SITE FOR RESIDUE FLC A 702
02AC2SOFTWAREPHE M:116 , GLN M:230 , HIS M:232 , LEU M:242 , GLU M:245 , ARG M:287 , HIS M:355 , ARG M:390 , ASN M:394BINDING SITE FOR RESIDUE FLC M 802
03AC3SOFTWARESER B:56 , CYS B:57 , ARG B:58 , CYS B:62 , GLY B:63 , CYS B:65 , CYS B:77BINDING SITE FOR RESIDUE FES B 244
04AC4SOFTWARECYS B:158 , GLN B:160 , CYS B:204 , THR B:205 , PHE B:206 , VAL B:207 , GLY B:208 , TYR B:209 , CYS B:210 , ALA B:221BINDING SITE FOR RESIDUE F3S B 245
05AC5SOFTWARECYS B:148 , ILE B:149 , CYS B:151 , GLY B:152 , CYS B:154 , CYS B:214BINDING SITE FOR RESIDUE SF4 B 246
06AC6SOFTWAREGLY A:11 , ALA A:12 , GLY A:14 , ALA A:15 , SER A:36 , LYS A:37 , SER A:43 , HIS A:44 , THR A:45 , ALA A:47 , ALA A:48 , GLN A:49 , GLY A:50 , GLY A:51 , HIS A:155 , VAL A:157 , THR A:192 , GLY A:193 , THR A:203 , ASN A:204 , ASP A:211 , MET A:215 , LEU A:242 , TYR A:356 , GLY A:378 , GLU A:379 , SER A:393 , SER A:395 , LEU A:396 , LEU A:399 , FLC A:702BINDING SITE FOR RESIDUE FAD A 703
07AC7SOFTWAREGLY C:45 , TRP C:56 , ILE C:123 , ALA C:127 , VAL D:35 , LEU D:49 , PHE D:57 , LEU D:67BINDING SITE FOR RESIDUE MQ7 D 700
08AC8SOFTWARELEU N:37 , CYS N:57 , ILE N:61 , CYS N:62 , GLY N:63 , SER N:64 , CYS N:65 , CYS N:77BINDING SITE FOR RESIDUE FES N 244
09AC9SOFTWARECYS N:158 , CYS N:204 , THR N:205 , PHE N:206 , VAL N:207 , GLY N:208 , TYR N:209 , CYS N:210 , ALA N:221 , ILE N:224 , GLN N:225BINDING SITE FOR RESIDUE F3S N 245
10BC1SOFTWARECYS N:148 , ILE N:149 , CYS N:151 , GLY N:152 , CYS N:154 , CYS N:214 , PRO N:215 , VAL N:218BINDING SITE FOR RESIDUE SF4 N 246
11BC2SOFTWAREVAL M:10 , GLY M:11 , ALA M:12 , GLY M:13 , GLY M:14 , ALA M:15 , SER M:36 , LYS M:37 , SER M:43 , HIS M:44 , THR M:45 , ALA M:47 , ALA M:48 , GLN M:49 , GLY M:50 , GLY M:51 , VAL M:157 , ALA M:191 , THR M:192 , THR M:203 , ASN M:204 , ILE M:207 , VAL M:208 , ASP M:211 , GLY M:212 , LEU M:242 , HIS M:355 , TYR M:356 , GLY M:378 , GLU M:379 , LEU M:396 , LEU M:399BINDING SITE FOR RESIDUE FAD M 803
12BC3SOFTWAREILE O:123 , VAL O:126 , VAL P:35 , LEU P:49 , PHE P:57 , ILE P:62 , PHE P:66 , LEU P:67BINDING SITE FOR RESIDUE MQ7 P 800

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2B76)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2B76)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2B76)

(-) PROSITE Motifs  (5, 10)

Asymmetric Unit (5, 10)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECO5716-97
 
  2B:15-96
N:15-96
FRDB_ECOL616-97
 
  2B:15-96
N:15-96
FRDB_ECOLI16-97
 
  2B:15-96
N:15-96
FRDB_SHIFL16-97
 
  2B:15-96
N:15-96
2FRD_SDH_FAD_BINDINGPS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.FRDA_ECOLI43-52
 
  2A:42-51
M:42-51
32FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FRDB_ECO5758-66
 
  2B:57-65
N:57-65
FRDB_ECOL658-66
 
  2B:57-65
N:57-65
FRDB_ECOLI58-66
 
  2B:57-65
N:57-65
FRDB_SHIFL58-66
 
  2B:57-65
N:57-65
44FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECO57140-169
 
  2B:139-168
N:139-168
FRDB_ECOL6140-169
 
  2B:139-168
N:139-168
FRDB_ECOLI140-169
 
  2B:139-168
N:139-168
FRDB_SHIFL140-169
 
  2B:139-168
N:139-168
54FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.FRDB_ECO57149-160
 
  2B:148-159
N:148-159
FRDB_ECOL6149-160
 
  2B:148-159
N:148-159
FRDB_ECOLI149-160
 
  2B:148-159
N:148-159
FRDB_SHIFL149-160
 
  2B:148-159
N:148-159
Biological Unit 1 (5, 17)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECO5716-97
 
  1B:15-96
-
FRDB_ECOL616-97
 
  1B:15-96
-
FRDB_ECOLI16-97
 
  1B:15-96
-
FRDB_SHIFL16-97
 
  1B:15-96
-
2FRD_SDH_FAD_BINDINGPS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.FRDA_ECOLI43-52
 
  1A:42-51
-
32FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FRDB_ECO5758-66
 
  1B:57-65
-
FRDB_ECOL658-66
 
  1B:57-65
-
FRDB_ECOLI58-66
 
  1B:57-65
-
FRDB_SHIFL58-66
 
  1B:57-65
-
44FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECO57140-169
 
  1B:139-168
-
FRDB_ECOL6140-169
 
  1B:139-168
-
FRDB_ECOLI140-169
 
  1B:139-168
-
FRDB_SHIFL140-169
 
  1B:139-168
-
54FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.FRDB_ECO57149-160
 
  1B:148-159
-
FRDB_ECOL6149-160
 
  1B:148-159
-
FRDB_ECOLI149-160
 
  1B:148-159
-
FRDB_SHIFL149-160
 
  1B:148-159
-
Biological Unit 2 (5, 17)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECO5716-97
 
  1-
N:15-96
FRDB_ECOL616-97
 
  1-
N:15-96
FRDB_ECOLI16-97
 
  1-
N:15-96
FRDB_SHIFL16-97
 
  1-
N:15-96
2FRD_SDH_FAD_BINDINGPS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.FRDA_ECOLI43-52
 
  1-
M:42-51
32FE2S_FER_1PS00197 2Fe-2S ferredoxin-type iron-sulfur binding region signature.FRDB_ECO5758-66
 
  1-
N:57-65
FRDB_ECOL658-66
 
  1-
N:57-65
FRDB_ECOLI58-66
 
  1-
N:57-65
FRDB_SHIFL58-66
 
  1-
N:57-65
44FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.FRDB_ECO57140-169
 
  1-
N:139-168
FRDB_ECOL6140-169
 
  1-
N:139-168
FRDB_ECOLI140-169
 
  1-
N:139-168
FRDB_SHIFL140-169
 
  1-
N:139-168
54FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.FRDB_ECO57149-160
 
  1-
N:148-159
FRDB_ECOL6149-160
 
  1-
N:148-159
FRDB_ECOLI149-160
 
  1-
N:148-159
FRDB_SHIFL149-160
 
  1-
N:148-159

(-) Exons   (0, 0)

(no "Exon" information available for 2B76)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:577
 aligned with FRDA_ECOLI | P00363 from UniProtKB/Swiss-Prot  Length:602

    Alignment length:577
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       
           FRDA_ECOLI     1 MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPA 577
               SCOP domains d2b76a2 A:0-225,A:358-442 Fumarate reductase                                                                                                                                                                                      d2b76a3 A:226-357 Fumarate reductase                                                                                                d2b76a2 A:0-225,A:358-442 Fumarate reductase                                         d2b76a1 A:443-576 Fumarate reductase                                                                                                   SCOP domains
               CATH domains 2b76A01 A:0-235,A:352-421  [code=3.50.50.60, no name defined]                                                                                                                                                                               2b76A02 A:236-351 Flavocytochrome C3; Chain A, domain 1                                                             2b76A01 A:0-235,A:352-421  [code=3.50.50.60, no name defined]         2b76A03 A:422-541  [code=1.20.58.100, no name defined]                                                                  2b76A04 A:542-576                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee...hhhhhhhhhhhhhh....eeee...hhhhhhhhhh...ee.......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.............ee.........ee.hhhhhhhhhhhhhhhhhhhh..eeee..eeeeeeeee..eeeeeeeee.....eeeee...eee....hhhhh..........hhhhhhhhh....ee....eeeeeee........hhhhhhh..eee.....hhhhh...............hhhhhhhhhhhhhhhhhhhh...ee....eeeeee....hhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeee..eee...........eee....ee..........hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eehhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.......ee..............eeeeeee.....eeeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ------------------------------------------FRD_SDH_FA--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 A   0 MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAQGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPA 576
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       

Chain B from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_ECO57 | P0AC49 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_ECO57     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d2b76b2 B:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d2b76b1 B:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -2b76B01 B:2-105  [code=3.10.20.30, no name defined]                                                     2b76B02 B:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee..............eeeeee....hhhhhhhhhhhhh..................eeee..eeee.hhhhhhhh...eeee......eee..ee.hhhhhhhhhhh.........hhhhh....hhhhhhhhhhhhh..........hhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------2FE2S_FER_2  PDB: B:15-96 UniProt: 16-97                                          --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_2  PDB: B:139-168   --------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (6)
                PROSITE (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------------------------2FE2S_FER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 B   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   

Chain B from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_ECOL6 | P0AC48 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_ECOL6     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d2b76b2 B:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d2b76b1 B:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -2b76B01 B:2-105  [code=3.10.20.30, no name defined]                                                     2b76B02 B:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee..............eeeeee....hhhhhhhhhhhhh..................eeee..eeee.hhhhhhhh...eeee......eee..ee.hhhhhhhhhhh.........hhhhh....hhhhhhhhhhhhh..........hhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------2FE2S_FER_2  PDB: B:15-96 UniProt: 16-97                                          --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (5)
                PROSITE (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------------------------2FE2S_FER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (1) ------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_2  PDB: B:139-168   --------------------------------------------------------------------------- PROSITE (1)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 B   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   

Chain B from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_ECOLI | P0AC47 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_ECOLI     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d2b76b2 B:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d2b76b1 B:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -2b76B01 B:2-105  [code=3.10.20.30, no name defined]                                                     2b76B02 B:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee..............eeeeee....hhhhhhhhhhhhh..................eeee..eeee.hhhhhhhh...eeee......eee..ee.hhhhhhhhhhh.........hhhhh....hhhhhhhhhhhhh..........hhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------2FE2S_FER_2  PDB: B:15-96 UniProt: 16-97                                          ------------------------------------------4FE4S_FER_2  PDB: B:139-168   --------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------------------------2FE2S_FER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (7)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 B   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   

Chain B from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_SHIFL | P0AC50 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_SHIFL     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d2b76b2 B:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d2b76b1 B:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -2b76B01 B:2-105  [code=3.10.20.30, no name defined]                                                     2b76B02 B:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee..............eeeeee....hhhhhhhhhhhhh..................eeee..eeee.hhhhhhhh...eeee......eee..ee.hhhhhhhhhhh.........hhhhh....hhhhhhhhhhhhh..........hhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhhh...hhhhh...hhhhhhh....hhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_2  PDB: B:139-168   --------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------2FE2S_FER_2  PDB: B:15-96 UniProt: 16-97                                          --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------2FE2S_FER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (8)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 B   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   

Chain C from PDB  Type:PROTEIN  Length:130
 aligned with FRDC_ECOLI | P0A8Q0 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:130
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
           FRDC_ECOLI     2 TTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW 131
               SCOP domains d2b76c1 C:1-130 Fumarate reductase subunit FrdC                                                                                    SCOP domains
               CATH domains 2b76C00 C:1-130 Fumarate reductase respiratory complex transmembrane subunits                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee..ee..hhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 C   1 TTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW 130
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain D from PDB  Type:PROTEIN  Length:119
 aligned with FRDD_ECOLI | P0A8Q3 from UniProtKB/Swiss-Prot  Length:119

    Alignment length:119
                                    10        20        30        40        50        60        70        80        90       100       110         
           FRDD_ECOLI     1 MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI 119
               SCOP domains d2b76d1 D:0-118 Fumarate reductase subunit FrdD                                                                         SCOP domains
               CATH domains 2b76D00 D:0-118 Fumarate reductase respiratory complex transmembrane subunits                                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 D   0 MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI 118
                                     9        19        29        39        49        59        69        79        89        99       109         

Chain M from PDB  Type:PROTEIN  Length:572
 aligned with FRDA_ECOLI | P00363 from UniProtKB/Swiss-Prot  Length:602

    Alignment length:572
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570  
           FRDA_ECOLI     1 MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKIT 572
               SCOP domains d2b76m2 M:0-225,M:358-442 Fumarate reductase                                                                                                                                                                                      d2b76m3 M:226-357 Fumarate reductase                                                                                                d2b76m2 M:0-225,M:358-442 Fumarate reductase                                         d2b76m1 M:443-571 Fumarate reductase                                                                                              SCOP domains
               CATH domains 2b76M01 M:0-235,M:352-421  [code=3.50.50.60, no name defined]                                                                                                                                                                               2b76M02 M:236-351 Flavocytochrome C3; Chain A, domain 1                                                             2b76M01 M:0-235,M:352-421  [code=3.50.50.60, no name defined]         2b76M03 M:422-541  [code=1.20.58.100, no name defined]                                                                  2b76M04 M:542-571              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee...eeee....hhhhhhhh.........eeee.........................hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh.............................hhhhhhhhhh.........eee...eee..............eee.....eeee...........hhhhh...........hhhhhh..............eeeee........hhhhhh...........hhhhhhh..................hhhhhhhhhhhhhhhh..eee..eeeeee.....hhhhhhhhhhhhhhhhhhhh........eeeeeee.........................................hhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhh............................ee...ee........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ------------------------------------------FRD_SDH_FA---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 M   0 MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAQGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKIT 571
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569  

Chain N from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_ECO57 | P0AC49 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_ECO57     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d2b76n2 N:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d2b76n1 N:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -2b76N01 N:2-105  [code=3.10.20.30, no name defined]                                                     2b76N02 N:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................................hhhhhhhhhhh.....................eee..eee.....hhhhh.....ee..............hhhhhhhhhh.......................hhhhhhhhh............hhhhh....hhhhhhhhhhhhh......hhhhhhhhh............hhhhhh....hhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------2FE2S_FER_2  PDB: N:15-96 UniProt: 16-97                                          --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_2  PDB: N:139-168   --------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (6)
                PROSITE (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) --------------------------------------------------------2FE2S_FER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (8)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 N   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   

Chain N from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_ECOL6 | P0AC48 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_ECOL6     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d2b76n2 N:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d2b76n1 N:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -2b76N01 N:2-105  [code=3.10.20.30, no name defined]                                                     2b76N02 N:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................................hhhhhhhhhhh.....................eee..eee.....hhhhh.....ee..............hhhhhhhhhh.......................hhhhhhhhh............hhhhh....hhhhhhhhhhhhh......hhhhhhhhh............hhhhhh....hhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------2FE2S_FER_2  PDB: N:15-96 UniProt: 16-97                                          --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (5)
                PROSITE (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------------------------2FE2S_FER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (1) ------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_2  PDB: N:139-168   --------------------------------------------------------------------------- PROSITE (1)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 N   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   

Chain N from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_ECOLI | P0AC47 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_ECOLI     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d2b76n2 N:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d2b76n1 N:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -2b76N01 N:2-105  [code=3.10.20.30, no name defined]                                                     2b76N02 N:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................................hhhhhhhhhhh.....................eee..eee.....hhhhh.....ee..............hhhhhhhhhh.......................hhhhhhhhh............hhhhh....hhhhhhhhhhhhh......hhhhhhhhh............hhhhhh....hhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------2FE2S_FER_2  PDB: N:15-96 UniProt: 16-97                                          ------------------------------------------4FE4S_FER_2  PDB: N:139-168   --------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------------------------2FE2S_FER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) ---------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (7)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 N   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   

Chain N from PDB  Type:PROTEIN  Length:243
 aligned with FRDB_SHIFL | P0AC50 from UniProtKB/Swiss-Prot  Length:244

    Alignment length:243
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   
           FRDB_SHIFL     2 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 244
               SCOP domains d2b76n2 N:1-105 Fumarate reductase iron-sulfur protein, N-terminal domain                                d2b76n1 N:106-243 Fumarate reductase                                                                                                       SCOP domains
               CATH domains -2b76N01 N:2-105  [code=3.10.20.30, no name defined]                                                     2b76N02 N:106-243 Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................................hhhhhhhhhhh.....................eee..eee.....hhhhh.....ee..............hhhhhhhhhh.......................hhhhhhhhh............hhhhh....hhhhhhhhhhhhh......hhhhhhhhh............hhhhhh....hhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_2  PDB: N:139-168   --------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) --------------2FE2S_FER_2  PDB: N:15-96 UniProt: 16-97                                          --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) --------------------------------------------------------2FE2S_FER---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (6)
                PROSITE (7) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (7)
                PROSITE (8) ---------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_FER_1 ------------------------------------------------------------------------------------ PROSITE (8)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 N   1 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR 243
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240   

Chain O from PDB  Type:PROTEIN  Length:130
 aligned with FRDC_ECOLI | P0A8Q0 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:130
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
           FRDC_ECOLI     2 TTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW 131
               SCOP domains d2b76o1 O:1-130 Fumarate reductase subunit FrdC                                                                                    SCOP domains
               CATH domains 2b76O00 O:1-130 Fumarate reductase respiratory complex transmembrane subunits                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee..ee..hhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 O   1 TTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW 130
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain P from PDB  Type:PROTEIN  Length:119
 aligned with FRDD_ECOLI | P0A8Q3 from UniProtKB/Swiss-Prot  Length:119

    Alignment length:119
                                    10        20        30        40        50        60        70        80        90       100       110         
           FRDD_ECOLI     1 MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI 119
               SCOP domains d2b76p1 P:0-118 Fumarate reductase subunit FrdD                                                                         SCOP domains
               CATH domains 2b76P00 P:0-118 Fumarate reductase respiratory complex transmembrane subunits                                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                 2b76 P   0 MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI 118
                                     9        19        29        39        49        59        69        79        89        99       109         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (7, 14)

Asymmetric Unit

(-) CATH Domains  (7, 16)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2B76)

(-) Gene Ontology  (28, 86)

Asymmetric Unit(hide GO term definitions)
Chain A,M   (FRDA_ECOLI | P00363)
molecular function
    GO:0071949    FAD binding    Interacting selectively and non-covalently with the oxidized form, FAD, of flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016627    oxidoreductase activity, acting on the CH-CH group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0044780    bacterial-type flagellum assembly    The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility.
    GO:0071973    bacterial-type flagellum-dependent cell motility    Cell motility due to the motion of one or more bacterial-type flagella. A bacterial-type flagellum is a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0022900    electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0006113    fermentation    The anaerobic enzymatic conversion of organic compounds, especially carbohydrates, coupling the oxidation and reduction of NAD/H and the generation of adenosine triphosphate (ATP).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045284    plasma membrane fumarate reductase complex    A membrane-bound flavoenzyme complex consisting of four subunits, A, B, C, and D. A and B comprise the membrane-extrinsic catalytic domain and C (InterPro:IPR003510; InterPro:IPR00224) and D (InterPro:IPR003418) link the catalytic centers to the electron-transport chain. In some species, the complex has only three subunits, and in these cases, there is only one membrane anchor instead of two. This family consists of the 13 kDa hydrophobic subunit D. This component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. Fumarate reductase couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, in a reaction opposite to that catalyzed by the related complex II of the respiratory chain (succinate dehydrogenase-(ubiquinone)). Examples of this component are found in bacterial species.

Chain B,N   (FRDB_SHIFL | P0AC50)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051538    3 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.

Chain B,N   (FRDB_ECOLI | P0AC47)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051538    3 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0044780    bacterial-type flagellum assembly    The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility.
    GO:0071973    bacterial-type flagellum-dependent cell motility    Cell motility due to the motion of one or more bacterial-type flagella. A bacterial-type flagellum is a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope.
    GO:0006113    fermentation    The anaerobic enzymatic conversion of organic compounds, especially carbohydrates, coupling the oxidation and reduction of NAD/H and the generation of adenosine triphosphate (ATP).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045284    plasma membrane fumarate reductase complex    A membrane-bound flavoenzyme complex consisting of four subunits, A, B, C, and D. A and B comprise the membrane-extrinsic catalytic domain and C (InterPro:IPR003510; InterPro:IPR00224) and D (InterPro:IPR003418) link the catalytic centers to the electron-transport chain. In some species, the complex has only three subunits, and in these cases, there is only one membrane anchor instead of two. This family consists of the 13 kDa hydrophobic subunit D. This component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. Fumarate reductase couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, in a reaction opposite to that catalyzed by the related complex II of the respiratory chain (succinate dehydrogenase-(ubiquinone)). Examples of this component are found in bacterial species.

Chain B,N   (FRDB_ECO57 | P0AC49)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051538    3 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.

Chain B,N   (FRDB_ECOL6 | P0AC48)
molecular function
    GO:0051537    2 iron, 2 sulfur cluster binding    Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051538    3 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.

Chain C,O   (FRDC_ECOLI | P0A8Q0)
molecular function
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0044780    bacterial-type flagellum assembly    The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility.
    GO:0071973    bacterial-type flagellum-dependent cell motility    Cell motility due to the motion of one or more bacterial-type flagella. A bacterial-type flagellum is a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope.
    GO:0006113    fermentation    The anaerobic enzymatic conversion of organic compounds, especially carbohydrates, coupling the oxidation and reduction of NAD/H and the generation of adenosine triphosphate (ATP).
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045284    plasma membrane fumarate reductase complex    A membrane-bound flavoenzyme complex consisting of four subunits, A, B, C, and D. A and B comprise the membrane-extrinsic catalytic domain and C (InterPro:IPR003510; InterPro:IPR00224) and D (InterPro:IPR003418) link the catalytic centers to the electron-transport chain. In some species, the complex has only three subunits, and in these cases, there is only one membrane anchor instead of two. This family consists of the 13 kDa hydrophobic subunit D. This component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. Fumarate reductase couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, in a reaction opposite to that catalyzed by the related complex II of the respiratory chain (succinate dehydrogenase-(ubiquinone)). Examples of this component are found in bacterial species.

Chain D,P   (FRDD_ECOLI | P0A8Q3)
molecular function
    GO:0008177    succinate dehydrogenase (ubiquinone) activity    Catalysis of the reaction: succinate + ubiquinone = fumarate + ubiquinol.
    GO:0000104    succinate dehydrogenase activity    Catalysis of the reaction: succinate + acceptor = fumarate + reduced acceptor.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0006113    fermentation    The anaerobic enzymatic conversion of organic compounds, especially carbohydrates, coupling the oxidation and reduction of NAD/H and the generation of adenosine triphosphate (ATP).
    GO:0006106    fumarate metabolic process    The chemical reactions and pathways involving fumarate, the anion of trans-1,2-ethenedicarboxylic acid, the diastereoisomer of maleate. It is a key intermediate in metabolism and is formed in the TCA cycle from succinate and converted into malate.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045284    plasma membrane fumarate reductase complex    A membrane-bound flavoenzyme complex consisting of four subunits, A, B, C, and D. A and B comprise the membrane-extrinsic catalytic domain and C (InterPro:IPR003510; InterPro:IPR00224) and D (InterPro:IPR003418) link the catalytic centers to the electron-transport chain. In some species, the complex has only three subunits, and in these cases, there is only one membrane anchor instead of two. This family consists of the 13 kDa hydrophobic subunit D. This component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. Fumarate reductase couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, in a reaction opposite to that catalyzed by the related complex II of the respiratory chain (succinate dehydrogenase-(ubiquinone)). Examples of this component are found in bacterial species.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    F3S  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MQ7  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SF4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2b76)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2b76
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FRDA_ECOLI | P00363
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDB_ECO57 | P0AC49
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDB_ECOL6 | P0AC48
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDB_ECOLI | P0AC47
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDB_SHIFL | P0AC50
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDC_ECOLI | P0A8Q0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FRDD_ECOLI | P0A8Q3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.3.99.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FRDA_ECOLI | P00363
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDB_ECO57 | P0AC49
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDB_ECOL6 | P0AC48
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDB_ECOLI | P0AC47
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDB_SHIFL | P0AC50
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDC_ECOLI | P0A8Q0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FRDD_ECOLI | P0A8Q3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FRDA_ECOLI | P003631kf6 1kfy 1l0v 3cir 3p4p 3p4q 3p4r 3p4s 4kx6 5vpn
        FRDB_ECO57 | P0AC495vpn
        FRDB_ECOLI | P0AC471kf6 1kfy 1l0v 3cir 3p4p 3p4q 3p4r 3p4s
        FRDC_ECOLI | P0A8Q01kf6 1kfy 1l0v 3cir 3p4p 3p4q 3p4r 3p4s 5vpn
        FRDD_ECOLI | P0A8Q31kf6 1kfy 1l0v 3cir 3p4p 3p4q 3p4r 3p4s 4kx6 5vpn

(-) Related Entries Specified in the PDB File

1kf6 1kfy 1l0v