|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4)
|
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 2YDW) |
(no "Cis Peptide Bond" information available for 2YDW) |
(no "SAP(SNP)/Variant" information available for 2YDW) |
Asymmetric Unit (2, 6)
|
Asymmetric Unit (3, 9)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:107 aligned with BRD2_HUMAN | P25440 from UniProtKB/Swiss-Prot Length:801 Alignment length:107 85 95 105 115 125 135 145 155 165 175 BRD2_HUMAN 76 TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ 182 SCOP domains d2ydwa_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------------BROMODOMAIN_2 PDB: A:91-163 UniProt: 91-163 ------------------- PROSITE (1) PROSITE (2) --------------------BROMODOMAIN_1 PDB: A:96-155 UniProt: 96-155 --------------------------- PROSITE (2) Transcript 1 Exon 1.16e PDB: A:76-111 Exon 1.17 PDB: A:112-157 UniProt: 112-157 Exon 1.18a PDB: A:158-18 Transcript 1 2ydw A 76 TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ 182 85 95 105 115 125 135 145 155 165 175 Chain B from PDB Type:PROTEIN Length:105 aligned with BRD2_HUMAN | P25440 from UniProtKB/Swiss-Prot Length:801 Alignment length:105 86 96 106 116 126 136 146 156 166 176 BRD2_HUMAN 77 NQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMP 181 SCOP domains d2ydwb_ B: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --------------BROMODOMAIN_2 PDB: B:91-163 UniProt: 91-163 ------------------ PROSITE (1) PROSITE (2) -------------------BROMODOMAIN_1 PDB: B:96-155 UniProt: 96-155 -------------------------- PROSITE (2) Transcript 1 Exon 1.16e PDB: B:77-111 Exon 1.17 PDB: B:112-157 UniProt: 112-157 Exon 1.18a [INCOMPLETE] Transcript 1 2ydw B 77 NQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMP 181 86 96 106 116 126 136 146 156 166 176 Chain C from PDB Type:PROTEIN Length:107 aligned with BRD2_HUMAN | P25440 from UniProtKB/Swiss-Prot Length:801 Alignment length:107 85 95 105 115 125 135 145 155 165 175 BRD2_HUMAN 76 TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ 182 SCOP domains d2ydwc_ C: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) --------Bromodomain-2ydwC01 C:84-168 -------------- Pfam domains (1) Pfam domains (2) --------Bromodomain-2ydwC02 C:84-168 -------------- Pfam domains (2) Pfam domains (3) --------Bromodomain-2ydwC03 C:84-168 -------------- Pfam domains (3) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------------BROMODOMAIN_2 PDB: C:91-163 UniProt: 91-163 ------------------- PROSITE (1) PROSITE (2) --------------------BROMODOMAIN_1 PDB: C:96-155 UniProt: 96-155 --------------------------- PROSITE (2) Transcript 1 Exon 1.16e PDB: C:76-111 Exon 1.17 PDB: C:112-157 UniProt: 112-157 Exon 1.18a PDB: C:158-18 Transcript 1 2ydw C 76 TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ 182 85 95 105 115 125 135 145 155 165 175
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2YDW) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (BRD2_HUMAN | P25440)
|
|
|
|
|
|
|