2OL7 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   THE CRYSTAL STRUCTURE OF OSPA MUTANT

Authors :   K. Makabe, V. Terechko, S. Koide

Date :   18 Jan 07 (Deposition) - 11 Dec 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.35

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Beta-Sheet, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Makabe, S. Yan, V. Tereshko, G. Gawlak, S. Koide
Beta-Strand Flipping And Slipping Triggered By Turn Replacement Reveal The Opportunistic Nature Of Beta-Strand Pairing
J. Am. Chem. Soc. V. 129 14661 2007
PubMed-ID: 17985889 | Reference-DOI: 10.1021/JA074252C
(for further references see the PDB file header)

Molecule 1 - OUTER SURFACE PROTEIN A
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET24A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 27-273
	Gene	:	OSPA
	Mutation	:	YES
	Organism Common	:	LYME DISEASE SPIROCHETE
	Organism Scientific	:	BORRELIA BURGDORFERI
	Organism Taxid	:	139

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2OL7)

(no "Site" information available for 2OL7)

(no "SS Bond" information available for 2OL7)

(no "Cis Peptide Bond" information available for 2OL7)

Asymmetric Unit (10, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_OSPA_BORBU_001 *	P	35	S	OSPA_BORBU	---	---	A/B	P	35	S
02	UniProt	VAR_OSPA_BORBU_002 *	K	39	N	OSPA_BORBU	---	---	A/B	K	39	N
03	UniProt	VAR_OSPA_BORBU_003 *	D	59	H	OSPA_BORBU	---	---	A/B	D	59	H
04	UniProt	VAR_OSPA_BORBU_004 *	I	90	V	OSPA_BORBU	---	---	A/B	I	90	V
05	UniProt	VAR_OSPA_BORBU_005 *	V	114	A	OSPA_BORBU	---	---	A/B	V	114	A
06	UniProt	VAR_OSPA_BORBU_006 *	N	127	S	OSPA_BORBU	---	---	A/B	I	127	S
07	UniProt	VAR_OSPA_BORBU_007 *	R	144	K	OSPA_BORBU	---	---	A/B	R	144	K
08	UniProt	VAR_OSPA_BORBU_008 *	G	149	E	OSPA_BORBU	---	---	A/B	G	149	E
09	UniProt	VAR_OSPA_BORBU_009 *	G	164	S	OSPA_BORBU	---	---	A/B	G	164	S
10	UniProt	VAR_OSPA_BORBU_010 *	E	196	A	OSPA_BORBU	---	---	A/B	E	196	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_OSPA_BORBU_001 *	P	35	S	OSPA_BORBU	---	---	A	P	35	S
02	UniProt	VAR_OSPA_BORBU_002 *	K	39	N	OSPA_BORBU	---	---	A	K	39	N
03	UniProt	VAR_OSPA_BORBU_003 *	D	59	H	OSPA_BORBU	---	---	A	D	59	H
04	UniProt	VAR_OSPA_BORBU_004 *	I	90	V	OSPA_BORBU	---	---	A	I	90	V
05	UniProt	VAR_OSPA_BORBU_005 *	V	114	A	OSPA_BORBU	---	---	A	V	114	A
06	UniProt	VAR_OSPA_BORBU_006 *	N	127	S	OSPA_BORBU	---	---	A	I	127	S
07	UniProt	VAR_OSPA_BORBU_007 *	R	144	K	OSPA_BORBU	---	---	A	R	144	K
08	UniProt	VAR_OSPA_BORBU_008 *	G	149	E	OSPA_BORBU	---	---	A	G	149	E
09	UniProt	VAR_OSPA_BORBU_009 *	G	164	S	OSPA_BORBU	---	---	A	G	164	S
10	UniProt	VAR_OSPA_BORBU_010 *	E	196	A	OSPA_BORBU	---	---	A	E	196	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_OSPA_BORBU_001 *	P	35	S	OSPA_BORBU	---	---	B	P	35	S
02	UniProt	VAR_OSPA_BORBU_002 *	K	39	N	OSPA_BORBU	---	---	B	K	39	N
03	UniProt	VAR_OSPA_BORBU_003 *	D	59	H	OSPA_BORBU	---	---	B	D	59	H
04	UniProt	VAR_OSPA_BORBU_004 *	I	90	V	OSPA_BORBU	---	---	B	I	90	V
05	UniProt	VAR_OSPA_BORBU_005 *	V	114	A	OSPA_BORBU	---	---	B	V	114	A
06	UniProt	VAR_OSPA_BORBU_006 *	N	127	S	OSPA_BORBU	---	---	B	I	127	S
07	UniProt	VAR_OSPA_BORBU_007 *	R	144	K	OSPA_BORBU	---	---	B	R	144	K
08	UniProt	VAR_OSPA_BORBU_008 *	G	149	E	OSPA_BORBU	---	---	B	G	149	E
09	UniProt	VAR_OSPA_BORBU_009 *	G	164	S	OSPA_BORBU	---	---	B	G	164	S
10	UniProt	VAR_OSPA_BORBU_010 *	E	196	A	OSPA_BORBU	---	---	B	E	196	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2OL7)

(no "Exon" information available for 2OL7)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:250
 aligned with OSPA_BORBU | P0CL66 from UniProtKB/Swiss-Prot  Length:273

    Alignment length:252
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271  
           OSPA_BORBU    22 SSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK 273
               SCOP domains d2o  l7a_ A: automated matches                                                                                                                                                                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------2ol7A02 A:128-273  [code=3.90.930.1, no name defined]                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...--..eeeee.....eeeee........eeeeeee..eeeeeee......eeeeee.....eeeeee.....eeeeeee......eeeeeeeee...eeeeeeee..eeeeeeeee....eeeee.......eeeeee....eeeeee...eeeeeeee..eeeeeeee....eeeeeee........eeeeee....eeeeee..eeeeeeee.....eeeee............ee..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------S---N-------------------H------------------------------V-----------------------A------------S----------------K----E--------------S-------------------------------A----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2ol7 A  24 SHM--KNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKIIIDGIIIEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK 273
                              |  |  31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271  
                             26 27

Chain A from PDB  Type:PROTEIN  Length:250
 aligned with Q45040_BORBG | Q45040 from UniProtKB/TrEMBL  Length:273

    Alignment length:252
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271  
         Q45040_BORBG    22 SSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK 273
               SCOP domains d2o  l7a_ A: automated matches                                                                                                                                                                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------2ol7A02 A:128-273  [code=3.90.930.1, no name defined]                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...--..eeeee.....eeeee........eeeeeee..eeeeeee......eeeeee.....eeeeee.....eeeeeee......eeeeeeeee...eeeeeeee..eeeeeeeee....eeeee.......eeeeee....eeeeee...eeeeeeee..eeeeeeee....eeeeeee........eeeeee....eeeeee..eeeeeeee.....eeeee............ee..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------S---N-------------------H------------------------------V-----------------------A------------S----------------K----E--------------S-------------------------------A----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2ol7 A  24 SHM--KNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKIIIDGIIIEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK 273
                              |  |  31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271  
                             26 27

Chain B from PDB  Type:PROTEIN  Length:246
 aligned with OSPA_BORBU | P0CL66 from UniProtKB/Swiss-Prot  Length:273

    Alignment length:246
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267      
           OSPA_BORBU    28 NSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK 273
               SCOP domains d2ol7b_ B: automated matches                                                                                                                                                                                                                           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------2ol7B02 B:128-273  [code=3.90.930.1, no name defined]                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.....eeee.........eeeeeee..eeeeeee......eeeeee.....eeeeee.....eeeeeee......eeeeeeeee....eeeeeee..eeeeeeee.....eeeee.......eeeeee....eeeeee....eeeeeee..eeeeeee.....eeeeeee........eeeeee....eeeeee..eeeeeeee.....eeeee............ee..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------S---N-------------------H------------------------------V-----------------------A------------S----------------K----E--------------S-------------------------------A----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2ol7 B  28 NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKIIIDGIIIEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK 273
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267

Chain B from PDB  Type:PROTEIN  Length:246
 aligned with Q45040_BORBG | Q45040 from UniProtKB/TrEMBL  Length:273

    Alignment length:246
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267      
         Q45040_BORBG    28 NSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK 273
               SCOP domains d2ol7b_ B: automated matches                                                                                                                                                                                                                           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------2ol7B02 B:128-273  [code=3.90.930.1, no name defined]                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.....eeee.........eeeeeee..eeeeeee......eeeeee.....eeeeee.....eeeeeee......eeeeeeeee....eeeeeee..eeeeeeee.....eeeee.......eeeeee....eeeeee....eeeeeee..eeeeeee.....eeeeeee........eeeeee....eeeeee..eeeeeeee.....eeeee............ee..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------S---N-------------------H------------------------------V-----------------------A------------S----------------K----E--------------S-------------------------------A----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2ol7 B  28 NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKIIIDGIIIEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK 273
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: open-sided beta-meander (34)

Superfamily: Outer surface protein (17)

Family: Outer surface protein (17)

Protein domain: automated matches (13)

Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139] (13)

1a	d2ol7a_	A:
1b	d2ol7b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Outer Surface Protein A; domain 3 (152)

Homologous Superfamily: [code=3.90.930.1, no name defined] (13)

Lyme disease spirochete (Borrelia burgdorferi) (11)

1a	2ol7A02	A:128-273
1b	2ol7B02	B:128-273

(no "Pfam Domain" information available for 2OL7)

Asymmetric Unit(hide GO term definitions)

Chain A,B (Q45040_BORBG | Q45040)

cellular component
	GO:0009279		cell outer membrane		A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.

Chain A,B (OSPA_BORBU | P0CL66)

cellular component
	GO:0009279		cell outer membrane		A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
	GO:0016020		membrane		A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ol7)

	Sites
(no "Sites" information available for 2ol7)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ol7)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ol7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	OSPA_BORBU \| P0CL66
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q45040_BORBG \| Q45040
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	OSPA_BORBU \| P0CL66
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q45040_BORBG \| Q45040
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	OSPA_BORBU \| P0CL66	:	1fj1 1osp 2af5 2fkg 2fkj 2g8c 2hkd 2i5v 2i5z 2ol6 2ol8 2oy1 2oy5 2oy7 2oy8 2oyb 2pi3 3aum 5b10 5b11
	Q45040_BORBG \| Q45040	:	2fkg 2fkj 2i5v 2i5z 2ol8 2oy1 2oy5 2oy7 2oy8 2oyb 5b2a
UniProtKB/TrEMBL
	Q45040_BORBG \| Q45040	:	2ol6 2pi3 3cka 3ckf 3ckg 5b3m

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (10, 20)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (2, 3)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File