Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF OSPA MUTANT
 
Authors :  K. Makabe
Date :  10 Feb 11  (Deposition) - 15 Feb 12  (Release) - 15 Feb 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  O
Keywords :  Beta-Mender, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Makabe
Crystal Structure Of Ospa Mutant
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - OUTER SURFACE PROTEIN A
    ChainsO
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentRESIDUES 27-273
    GeneOSPA
    MutationYES
    Organism CommonLYME DISEASE SPIROCHETE
    Organism ScientificBORRELIA BURGDORFERI
    Organism Taxid139

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit O

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3AUM)

(-) Sites  (0, 0)

(no "Site" information available for 3AUM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3AUM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3AUM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (10, 10)

Asymmetric/Biological Unit (10, 10)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_OSPA_BORBU_001 *P35SOSPA_BORBU  ---  ---OP35S
02UniProtVAR_OSPA_BORBU_002 *K39NOSPA_BORBU  ---  ---OK39N
03UniProtVAR_OSPA_BORBU_003 *D59HOSPA_BORBU  ---  ---OD59H
04UniProtVAR_OSPA_BORBU_004 *I90VOSPA_BORBU  ---  ---OI90V
05UniProtVAR_OSPA_BORBU_005 *V114AOSPA_BORBU  ---  ---OV114A
06UniProtVAR_OSPA_BORBU_006 *N127SOSPA_BORBU  ---  ---ON127S
07UniProtVAR_OSPA_BORBU_007 *R144KOSPA_BORBU  ---  ---OR144K
08UniProtVAR_OSPA_BORBU_008 *G149EOSPA_BORBU  ---  ---OG149E
09UniProtVAR_OSPA_BORBU_009 *G164SOSPA_BORBU  ---  ---OG164S
10UniProtVAR_OSPA_BORBU_010 *E196AOSPA_BORBU  ---  ---OE196A
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3AUM)

(-) Exons   (0, 0)

(no "Exon" information available for 3AUM)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain O from PDB  Type:PROTEIN  Length:247
 aligned with OSPA_BORBN | C6C2D6 from UniProtKB/Swiss-Prot  Length:273

    Alignment length:247
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       
           OSPA_BORBN    27 KNSVSVDLPGEMNVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTEIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK 273
               SCOP domains d3aumo_ O: automated matches                                                                                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.....eeeee........eeeeeee..eeeeeee......eeeeee.....eeeeee.....eeeeeee......eeeeeeee...eeeeeee.....eeeeeeee....eeeee.......eeeeeee..eeeeeee...eeeeeeee..eeeeeeee....eeeeeee........eeeeee....eeeeee..eeeeeeee.....eeeee............ee..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------S---N-------------------H------------------------------V-----------------------A------------S----------------K----E--------------S-------------------------------A----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3aum O  27 KNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVYKYVYSKDKSYTWEYFNEKGEVSYKYIYRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK 273
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       

Chain O from PDB  Type:PROTEIN  Length:247
 aligned with OSPA_BORBU | P0CL66 from UniProtKB/Swiss-Prot  Length:273

    Alignment length:247
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       
           OSPA_BORBU    27 KNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLEGSAVEITKLDEIKNALK 273
               SCOP domains d3aumo_ O: automated matches                                                                                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.....eeeee........eeeeeee..eeeeeee......eeeeee.....eeeeee.....eeeeeee......eeeeeeee...eeeeeee.....eeeeeeee....eeeee.......eeeeeee..eeeeeee...eeeeeeee..eeeeeeee....eeeeeee........eeeeee....eeeeee..eeeeeeee.....eeeee............ee..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------S---N-------------------H------------------------------V-----------------------A------------S----------------K----E--------------S-------------------------------A----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3aum O  27 KNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVYKYVYSKDKSYTWEYFNEKGEVSYKYIYRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK 273
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3AUM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3AUM)

(-) Gene Ontology  (2, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain O   (OSPA_BORBN | C6C2D6)
cellular component
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain O   (OSPA_BORBU | P0CL66)
cellular component
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3aum)
 
  Sites
(no "Sites" information available for 3aum)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3aum)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3aum
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  OSPA_BORBN | C6C2D6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  OSPA_BORBU | P0CL66
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  OSPA_BORBN | C6C2D6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  OSPA_BORBU | P0CL66
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        OSPA_BORBN | C6C2D61fj1 1osp 2af5 2g8c
        OSPA_BORBU | P0CL661fj1 1osp 2af5 2fkg 2fkj 2g8c 2hkd 2i5v 2i5z 2ol6 2ol7 2ol8 2oy1 2oy5 2oy7 2oy8 2oyb 2pi3 5b10 5b11

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3AUM)