|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2MEM) |
Sites (0, 0)| (no "Site" information available for 2MEM) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2MEM) |
Cis Peptide Bonds (2, 40)
NMR Structure
|
|||||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MEM) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2MEM) |
Exons (3, 3)
NMR Structure (3, 3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:119 aligned with SCML2_HUMAN | Q9UQR0 from UniProtKB/Swiss-Prot Length:700 Alignment length:121 357 367 377 387 397 407 417 427 437 447 457 467 SCML2_HUMAN 348 GPCKIVMSTVCVYVNKHGNFGPHLDPKRIQQLPDHFGPGPVNVVLRRIVQACVDCALETKTVFGYLKPDNRGGEVITASFDGETHSIQLPPVNSASFALRFLENFCHSLQCDNLLSSQPFS 468 SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2MEM) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MEM) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MEM) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (SCML2_HUMAN | Q9UQR0)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|