1OI1 - JenaLib

Title :   CRYSTAL STRUCTURE OF THE MBT DOMAINS OF HUMAN SCML2

Authors :   A. Sathyamurthy, M. D. Allen, A. G. Murzin, M. Bycroft

Date :   04 Jun 03 (Deposition) - 15 Jun 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.78

Chains :   Asym./Biol. Unit : A

Keywords :   Mbt, Scml2, Crystal Structure (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Sathyamurthy, M. D. Allen, A. G. Murzin, M. Bycroft
Crystal Structure Of The Malignant Brain Tumor (Mbt) Repeats In Sex Comb On Midleg-Like 2 (Scml2).
J. Biol. Chem. V. 278 46968 2003
PubMed-ID: 12952983 | Reference-DOI: 10.1074/JBC.M306469200

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (4, 4)

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000251900	1a	ENSE00001341544	X:18372847-18372712	136	SCML2_HUMAN	-	0	0	-	-
1.2	ENST00000251900	2	ENSE00002195410	X:18352215-18352170	46	SCML2_HUMAN	1-8	8	0	-	-
1.3	ENST00000251900	3	ENSE00001740872	X:18348775-18348707	69	SCML2_HUMAN	8-31	24	0	-	-
1.4	ENST00000251900	4	ENSE00001722015	X:18343097-18343027	71	SCML2_HUMAN	31-54	24	1	A:33-54	22
1.5	ENST00000251900	5	ENSE00001761590	X:18342213-18341979	235	SCML2_HUMAN	55-133	79	1	A:55-133	79
1.6	ENST00000251900	6	ENSE00001802908	X:18338540-18338452	89	SCML2_HUMAN	133-162	30	1	A:133-162 (gaps)	30
1.7	ENST00000251900	7	ENSE00001780951	X:18323335-18323092	244	SCML2_HUMAN	163-244	82	1	A:163-243	81
1.8	ENST00000251900	8	ENSE00001602863	X:18283922-18283705	218	SCML2_HUMAN	244-316	73	0	-	-
1.9	ENST00000251900	9	ENSE00001692459	X:18278411-18278291	121	SCML2_HUMAN	317-357	41	0	-	-
1.10	ENST00000251900	10	ENSE00001801055	X:18276367-18276164	204	SCML2_HUMAN	357-425	69	0	-	-
1.11	ENST00000251900	11	ENSE00001720943	X:18275150-18274968	183	SCML2_HUMAN	425-486	62	0	-	-
1.12b	ENST00000251900	12b	ENSE00001776891	X:18266002-18265889	114	SCML2_HUMAN	486-524	39	0	-	-
1.13	ENST00000251900	13	ENSE00001632032	X:18264948-18264697	252	SCML2_HUMAN	524-608	85	0	-	-
1.14	ENST00000251900	14	ENSE00000666137	X:18260710-18260559	152	SCML2_HUMAN	608-658	51	0	-	-
1.15b	ENST00000251900	15b	ENSE00001765000	X:18259499-18257434	2066	SCML2_HUMAN	659-700	42	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:207
 aligned with SCML2_HUMAN | Q9UQR0 from UniProtKB/Swiss-Prot  Length:700

    Alignment length:211
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242 
          SCML2_HUMAN    33 FHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLKTLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS 243
               SCOP domains d1oi1a1 A:33-135 Scml2 protein                                                                         ----d1oi1a2 A:140-243 Scml2 protein                                                                          SCOP domains
               CATH domains 1oi1A01 A:33-58,A:163-243 1oi1A02 A:59-162  [code=2.30.30.160, no name defined]                                                   1oi1A01 A:33-58,A:163-243  [code=2.30.30.160, no name defined]                    CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------------------------------------------------------------MBT-1oi1A01 A:176-243                                                Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------------------------------------------------------------MBT-1oi1A02 A:176-243                                                Pfam domains (2)
         Sec.struct. author .hhhhhhhhh.....hhhhh...............eeeeee..eeeeeeeeeeeeee..eeeeee........eeee.....ee..hhhhhh...........----hhhhhhhhhhh.....hhhhh................eeeee.......eeeeeeeeee..eeeeee........eeee.....ee..hhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE MBT  PDB: A:33-131 UniProt: 33-131                                                                 -------MBT  PDB: A:140-240 UniProt: 139-240                                                                  --- PROSITE
           Transcript 1 (1) Exon 1.4  PDB: A:33-54Exon 1.5  PDB: A:55-133 UniProt: 55-133                                        -----------------------------Exon 1.7  PDB: A:163-243 UniProt: 163-244 [INCOMPLETE]                            Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------Exon 1.6  PDB: A:133-162 (gaps--------------------------------------------------------------------------------- Transcript 1 (2)
                 1oi1 A  33 FHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQ----SWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS 243
                                    42        52        62        72        82        92       102       112       122       132  |    142       152       162       172       182       192       202       212       222       232       242 
                                                                                                                                135  140

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (SCML2_HUMAN | Q9UQR0)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
	GO:0009653	anatomical structure morphogenesis	The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0031519	PcG protein complex	A chromatin-associated multiprotein complex containing Polycomb Group proteins. In Drosophila, Polycomb group proteins are involved in the long-term maintenance of gene repression, and PcG protein complexes associate with Polycomb group response elements (PREs) in target genes to regulate higher-order chromatin structure.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PEG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1oi1)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1oi1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SCML2_HUMAN \| Q9UQR0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description