|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2MD9) |
Sites (0, 0)| (no "Site" information available for 2MD9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2MD9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2MD9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MD9) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2MD9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:90 aligned with TYCC_BREPA | O30409 from UniProtKB/Swiss-Prot Length:6486 Alignment length:171 3041 3051 3061 3071 3081 3091 3101 3111 3121 3131 3141 3151 3161 3171 3181 3191 3201 TYCC_BREPA 3032 PVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATSGKETYVPIEPAPLQEYYPVSSAQKRMYVLRQFADTGTVYNMPSALYIEGDLDRKRFEAAIHGLVERHESLRTSFHTVNGEPVQRVHEH 3202 SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2MD9) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MD9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MD9) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (TYCC_BREPA | O30409)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|