|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (6, 10)
NMR Structure (6, 10)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2MC0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2MC0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MC0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2MC0) |
Exons (0, 0)| (no "Exon" information available for 2MC0) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:143 aligned with TIPA_STRLI | P0A4T9 from UniProtKB/Swiss-Prot Length:253 Alignment length:143 120 130 140 150 160 170 180 190 200 210 220 230 240 250 TIPA_STRLI 111 GINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGYEMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP 253 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2mc0 A 111 GINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGYEMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP 253 120 130 140 150 160 170 180 190 200 210 220 230 240 250
Chain B from PDB Type:PROTEIN Length:13
SCOP domains ------------- SCOP domains
CATH domains ------------- CATH domains
Pfam domains ------------- Pfam domains
SAPs(SNPs) ------------- SAPs(SNPs)
PROSITE ------------- PROSITE
Transcript ------------- Transcript
2mc0 B 501 ScTtcecCcscAx 513
| ||||510| |
502-BB9| ||| |
504-DBU||| |
505-BB9|| |
506-3GL| |
507-BB9 |
509-BB9
510-MH6
511-BB9
513-NH2
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2MC0) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MC0) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MC0) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (TIPA_STRLI | P0A4T9)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|