|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1NY9) |
(no "Site" information available for 1NY9) |
(no "SS Bond" information available for 1NY9) |
(no "Cis Peptide Bond" information available for 1NY9) |
(no "SAP(SNP)/Variant" information available for 1NY9) |
(no "PROSITE Motif" information available for 1NY9) |
(no "Exon" information available for 1NY9) |
NMR StructureChain A from PDB Type:PROTEIN Length:94 aligned with TIPA_STRLI | P0A4T9 from UniProtKB/Swiss-Prot Length:253 Alignment length:94 169 179 189 199 209 219 229 239 249 TIPA_STRLI 160 WQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGYEMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP 253 SCOP domains d1ny9a_ A: Transcriptional activator TipA-S SCOP domains CATH domains 1ny9A00 A:160-253 Antibiotic binding domain of TipA-like multidrug resistance regulators CATH domains Pfam domains TipAS-1ny9A01 A:160-248 ----- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------- Transcript 1ny9 A 160 WQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGYEMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP 253 169 179 189 199 209 219 229 239 249
|
NMR Structure |
NMR Structure
|
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A (TIPA_STRLI | P0A4T9)
|
|
|
|
|
|
|