|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2VZ4) |
Sites (0, 0)| (no "Site" information available for 2VZ4) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2VZ4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2VZ4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2VZ4) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2VZ4) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:100 aligned with TIPA_STRLI | P0A4T9 from UniProtKB/Swiss-Prot Length:253 Alignment length:105 11 21 31 41 51 61 71 81 91 101 TIPA_STRLI 2 SYSVGQVAGFAGVTVRTLHHYDDIGLLVPSERSHAGHRRYSDADLDRLQQILFYRELGFPLDEVAALLDDPAADPRAHLRRQHELLSARIGKLQKMAAAVEQAME 106 SCOP domains d2vz4a_ A: automated matches SCOP domains CATH domains 2vz4A00 A:2-106 [code=1.10.1660.10, no name defined] CATH domains Pfam domains --MerR-2vz4A01 A:4-41 ----MerR-DNA-bind-2vz4A02 A:46 -104 -- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----HTH_MERR_1 PDB: A:6-28------------------------------------------------------------------------------ PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 2vz4 A 2 SYSVGQVAGFAGVTVRTLHHYDDIGLLVPSERSHAGHRRYSDADLDRLQQILFYRELGFPLDEVAALLDD-----RAHLRRQHELLSARIGKLQKMAAAVEQAME 106 11 21 31 41 51 61 71 | 81 91 101 71 77
Chain B from PDB Type:DNA Length:21
2vz4 B -11 CTCCTCACGTCACGTGAGGTG 11
-2| 10
-2|
1
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (2, 2)
Asymmetric Unit
|
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (TIPA_STRLI | P0A4T9)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|