|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2MAL) |
Sites (0, 0)| (no "Site" information available for 2MAL) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (1, 20)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MAL) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2MAL) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:93 aligned with NLTP2_LENCU | A0AT29 from UniProtKB/Swiss-Prot Length:118 Alignment length:93 35 45 55 65 75 85 95 105 115 NLTP2_LENCU 26 AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 118 SCOP domains d2mala_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------PLANT_LTP PDB: A:70-9-- PROSITE Transcript --------------------------------------------------------------------------------------------- Transcript 2mal A 1 AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 93 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MAL) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MAL) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (NLTP2_LENCU | A0AT29)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|